CRABP2 Monoclonal antibody

• 

  WB analysis of T-47D using 66468-1-Ig

  T-47D cells were subjected to SDS PAGE followed by western blot with 66468-1-Ig (CRABP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66468-1-Ig

  WB result of CRABP2 antibody (66468-1-Ig; 1:500; incubated at room temperature for 1.5 hours) with sh-Control and sh-CRABP2 transfected HEK-293 cells.

• 

  WB analysis of MCF-7 using 66468-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66468-1-Ig (CRABP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skin using 66468-1-Ig

  rat skin tissue were subjected to SDS PAGE followed by western blot with 66468-1-Ig (CRABP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig skin using 66468-1-Ig

  pig skin tissue were subjected to SDS PAGE followed by western blot with 66468-1-Ig (CRABP2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 66468-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66468-1-Ig (CRABP2 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 66468-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66468-1-Ig (CRABP2 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human skin cancer using 66468-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human skin cancer tissue using CRABP2 antibody (66468-1-Ig, Clone: 1A5F3 ) at dilution of 1:100 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• 

  IF Staining of MCF-7 using 66468-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CRABP2 antibody (66468-1-Ig, Clone: 1A5F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

• 

  FC experiment of MCF-7 using 66468-1-Ig

  1X10^6 MCF-7 cells were intracellularly stained with 0.4 ug Anti-Human CRABP2 (66468-1-Ig, Clone:1A5F3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

CRABP2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 66468-1-Ig

Clone No.1A5F3

Publications(3)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

1A5F3, Cellular retinoic acid binding protein II, Cellular retinoic acid-binding protein 2, Cellular retinoic acid-binding protein II, CRABP II

---

Tested Applications

• Positive WB detected in: T-47D cells, HEK-293 cells, MCF-7 cells, pig skin tissue, rat skin tissue
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human skin cancer tissue
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:2500-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 2 publications below
• IF: See 2 publications below

Product Information

66468-1-Ig targets CRABP2 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0309

  Product name: Recombinant human CRABP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-138 aa of BC001109

  Sequence: MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE

• Full Name: cellular retinoic acid binding protein 2
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC001109
• Gene Symbol: CRABP2
• Gene ID (NCBI): 1382
• RRID: AB_2881836
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P29373
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cellular retinoic acid binding protein 2 (CRABP2, synonyms: RBP6, CRABP-II). A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. CRABP2 is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	PLoS One; Increased sensitivity of primary aniridia limbal stromal cells to travoprost, leading to elevated migration and MMP-9 protein levels, in vitro; Authors - Shuailin Li
mouse,human	IHC,IF	Cell Death Dis; Upregulation of CRABP2 by TET1-mediated DNA hydroxymethylation attenuates mitochondrial apoptosis and promotes oxaliplatin resistance in gastric cancer; Authors - Xiaolong Tang
human	WB,IHC,IF	Cell Signal; CRABP2 promotes peritoneal metastasis in CRC through TGF-β/Smad-mediated EMT signaling and invadopodia formation; Authors - Wende Hao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Linyi (Verified Customer) (01-17-2019)

We use this antibody on porcine chondrocytes lysate, 1/1000 dilution.

• Applications: Western Blot,
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: chondrocytes, pig

CRABP2 Antibody Western Blot, validation (1/1000 dilution) in chondrocytes, pig (Cat no:66468-1-Ig)