CPT1B-specific Polyclonal antibody

• 

  WB analysis using 22170-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22170-1-AP (CPT1B-specific antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skeletal muscle using 22170-1-AP

  Rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22170-1-AP (CPT1B-specific antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 22170-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22170-1-AP (CPT1B-specific antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 22170-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 22170-1-AP (CPT1B-specific antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse heart using 22170-1-AP

  IP result of anti-CPT1B-specific (IP:22170-1-AP, 4ug; Detection:22170-1-AP 1:600) with mouse heart tissue lysate 3600 ug.

• 

  IP experiment of mouse skeletal muscle using 22170-1-AP

  IP result of anti-CPT1B-specific (IP:22170-1-AP, 4ug; Detection:22170-1-AP 1:600) with mouse skeletal muscle tissue lysate 2200ug.

• 

  IHC staining of mouse heart using 22170-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 22170-1-AP (CPT1B-specific antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 22170-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 22170-1-AP (CPT1B-specific antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 22170-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using CPT1B-specific antibody (22170-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 22170-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using CPT1B-specific antibody (22170-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CPT1B-specific Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 22170-1-AP

Publications(82)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

CPT1B, Carnitine O palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase I-like protein

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat heart tissue
• Positive IP detected in: mouse heart tissue, mouse skeletal muscle tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 76 publications below
• IHC: See 3 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

22170-1-AP targets CPT1B-specific in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, zebrafish, sheep, ewes
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17840

  Product name: Recombinant human CPT1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-250 aa of BC131570

  Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF

• Full Name: carnitine palmitoyltransferase 1B (muscle)
• Calculated Molecular Weight: 567 aa, 64 kDa
• Observed Molecular Weight: 75-85 kDa
• GenBank Accession Number: BC131570
• Gene Symbol: CPT1B
• Gene ID (NCBI): 1375
• RRID: AB_2713959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92523
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carnitine palmitoyltransferases (CPTs) mediate the transport of long chain fatty acyl groups into the mitochondrial matrix to undergo b-oxidation. Type I CPT resides in the outer mitochondrial membrane. Mammalian tissues express three isoforms: CPT1A (liver), CPT1B (muscle and heart), and CPT1C (brain). Several isoforms of CPT1B exist due to the alternative splicing, with predicted MW of 88/84/79/66 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Cell Metab; A mechanosensitive lipolytic factor in the bone marrow promotes osteogenesis and lymphopoiesis.; Authors - Hui Peng
mouse	WB	Cell Metab; Global Analysis of Plasma Lipids Identifies Liver-Derived Acylcarnitines as a Fuel Source for Brown Fat Thermogenesis.; Authors - Judith Simcox ; KD Validated
mouse	WB	Nat Commun; Moderate-intensity interval exercise exacerbates cardiac lipotoxicity in high-fat, high-calories diet-fed mice; Authors - Jing Geng
human	WB	Adv Sci (Weinh); m6A-Modified circTET2 Interacting with HNRNPC Regulates Fatty Acid Oxidation to Promote the Proliferation of Chronic Lymphocytic Leukemia; Authors - Zijuan Wu
mouse	WB	Nat Commun; Mechanism of action and therapeutic route for a muscular dystrophy caused by a genetic defect in lipid metabolism.; Authors - Mahtab Tavasoli
human	WB	J Biomed Sci; Adipocyte pyroptosis occurs in omental tumor microenvironment and is associated with chemoresistance of ovarian cancer; Authors - Chang-Ni Lin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xhuljana (Verified Customer) (03-01-2024)

Tried in WB in C2C12 lysate, 30 *g

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: C2C12 cells

CPT1B-specific Antibody Western Blot validation (1:1000 dilution) in C2C12 cells (Cat no:22170-1-AP)

FH

James (Verified Customer) (04-01-2021)

Green channel is CPT1B.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: lung

CPT1B-specific Antibody Immunofluorescence validation (1:100 dilution) in lung (Cat no:22170-1-AP)