Tested Applications
| Positive WB detected in | mouse heart tissue, human brain tissue, human kidney tissue |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
11413-1-AP targets COX7A1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1981 Product name: Recombinant human COX7A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC002757 Sequence: MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN Predict reactive species |
| Full Name | cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) |
| Calculated Molecular Weight | 79 aa, 9 kDa |
| Observed Molecular Weight | 7-9 kDa |
| GenBank Accession Number | BC002757 |
| Gene Symbol | COX7A1 |
| Gene ID (NCBI) | 1346 |
| RRID | AB_2085705 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24310 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cytochrome c oxidase(COX) catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen. Subunit VIIa of mammalian COX exists in at least 2 isoforms, liver and muscle. COX7A1(Cytochrome c oxidase subunit 7A1, mitochondrial) is also named as COX7AH, cytochrome c oxidase subunit VIIa-H, cytochrome c oxidase subunit VIIa-M and is the muscle isoform of COX subunit VIIa. Northern-blot analysis of primate tissues demonstrated that COXVIIa-M mRNA is present only in muscle tissues(PMID:1327965).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COX7A1 antibody 11413-1-AP | Download protocol |
| WB protocol for COX7A1 antibody 11413-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Lab Invest Overexpression of COX7A1 Promotes the Resistance of Gastric Cancer to Oxaliplatin and Weakens the Efficacy of Immunotherapy | ||
Int J Biochem Cell Biol Investigating the role of the physiological isoform switch of cytochrome c oxidase subunits in reversible mitochondrial disease. | ||
Cell Death Dis BNIP3-mediated mitophagy boosts the competitive growth of Lenvatinib-resistant cells via energy metabolism reprogramming in HCC | ||
Biochim Biophys Acta Mol Cell Res Blockade of angiotensin II modulates insulin-like growth factor 1-mediated skeletal muscle homeostasis in experimental steatohepatitis |







