"COXIV Antibodies" Comparison
View side-by-side comparison of COXIV antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, rat brain tissue, rat liver tissue, mouse heart tissue, mouse liver tissue, mouse lung tissue, Jurkat cells, NIH/3T3 cells, mouse skeletal muscle tissue, MCF-7 cells |
| Positive IP detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | human prostate cancer tissue, human pancreas cancer tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11242-1-AP targets COXIV in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, bovine, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1640 Product name: Recombinant human COXIV protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC021236 Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Predict reactive species |
| Full Name | cytochrome c oxidase subunit IV isoform 1 |
| Calculated Molecular Weight | 19.6 kDa |
| Observed Molecular Weight | 17-18 kDa |
| GenBank Accession Number | BC021236 |
| Gene Symbol | COX IV |
| Gene ID (NCBI) | 1327 |
| RRID | AB_2085278 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13073 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody was generated against full length COX4I1 protein and cross reacts with COX4I2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for COXIV antibody 11242-1-AP | Download protocol |
| IHC protocol for COXIV antibody 11242-1-AP | Download protocol |
| IP protocol for COXIV antibody 11242-1-AP | Download protocol |
| WB protocol for COXIV antibody 11242-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-VDAC antibody (Cat# 11242-1-AP) has accumulated 655 citations across high-impact journals including Nature, Science, Cell Metabolism, Cell Research, Nature Metabolism, Nature Communications, Autophagy, Cell Death & Disease, and Science Advances. Research fields span mitochondrial biology, cancer metabolism, neurodegeneration, cardiovascular disease, autophagy/mitophagy, oxidative stress, diabetes, and regenerative medicine.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Protein C receptor maintains cancer stem cell properties via activating lipid synthesis in nasopharyngeal carcinoma. | ||
Science Boosting neuronal activity-driven mitochondrial DNA transcription improves cognition in aged mice | ||
Circulation Nuclear Receptor NR1D1 Regulates Abdominal Aortic Aneurysm Development by Targeting the Mitochondrial Tricarboxylic Acid Cycle Enzyme Aconitase-2 | ||
Cell Metab Derepressing nuclear pyruvate dehydrogenase induces therapeutic cancer cell reprogramming | ||
Cell Metab Pyruvate metabolism enzyme DLAT promotes tumorigenesis by suppressing leucine catabolism |
Reviews
What customers say
Users report consistently positive results with this antibody across 7 reviews (average ~4.7/5). It performs well in Western Blot and Immunofluorescence, producing clear bands at the expected molecular weight with strong signal. Tested successfully in mouse heart mitochondria, human fibroblasts, HEK293 cells, primary human cell fractions, and isolated sperm. One user noted a slightly diffuse band, but overall specificity is praised. Recommended dilutions range from 1:500 to 1:1000 for WB and 1:200 for IF.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xinyi (Verified Customer) (08-28-2026) | We use COXIV rabbit polyAB to detect mitochondria amount in our mouse heart tissues and it works perfectly.
|
Matthieu (Verified Customer) (09-24-2025) | Slightly diffuse band at the expected size
|
Vignesh (Verified Customer) (09-03-2025) | Good product with good specificity.
|
Jimmy (Verified Customer) (02-27-2024) | Strong signal in primary human cell fractions.
|
Maria (Verified Customer) (08-17-2021) | Good ab, works well 1:1000 in BSA 3% O/N 4ºC incubation.
 |
Mohammed (Verified Customer) (08-19-2020) | Very strong staining in the midpiece of the sperm tail.
|
SITING (Verified Customer) (07-13-2020) | THIS IS A GOOD ANTIBODY, CAN SEE CLEAR BAND
 |
