"COXIV Antibodies" Comparison
View side-by-side comparison of COXIV antibodies from other vendors to find the one that best suits your research needs.
Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, rat liver tissue, rat brain tissue, MCF-7 cells, NIH/3T3 cells, Jurkat cells, mouse skeletal muscle tissue |
Positive IP detected in | mouse skeletal muscle tissue |
Positive IHC detected in | human prostate cancer tissue, human pancreas cancer tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:20000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 447 publications below |
IHC | See 9 publications below |
IF | See 52 publications below |
IP | See 3 publications below |
ChIP | See 1 publications below |
Product Information
11242-1-AP targets COXIV in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, canine, bovine, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1640 Product name: Recombinant human COXIV protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC021236 Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK Predict reactive species |
Full Name | cytochrome c oxidase subunit IV isoform 1 |
Calculated Molecular Weight | 19.6 kDa |
Observed Molecular Weight | 17-18 kDa |
GenBank Accession Number | BC021236 |
Gene Symbol | COX IV |
Gene ID (NCBI) | 1327 |
RRID | AB_2085278 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P13073 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COX4I1, also named as COX4 and COXIV-1, belongs to the cytochrome c oxidase IV family. It is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. COX4I1 is a marker for mitochondria. It has two isoforms (isoform 1 and 2). Isoform 1(COX4I1) is ubiquitously expressed and isoform 2 is highly expressed in lung tissues. COX4I1 is commonly used as a loading control. This antibody was generated against full length COX4I1 protein and cross reacts with COX4I2.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for COXIV antibody 11242-1-AP | Download protocol |
IHC protocol for COXIV antibody 11242-1-AP | Download protocol |
IF protocol for COXIV antibody 11242-1-AP | Download protocol |
IP protocol for COXIV antibody 11242-1-AP | Download protocol |
FC protocol for COXIV antibody 11242-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Res Nonenzymatic lysine D-lactylation induced by glyoxalase II substrate SLG dampens inflammatory immune responses | ||
Cell Res Mitochondria-localized cGAS suppresses ferroptosis to promote cancer progression | ||
Immunity Excessive Polyamine Generation in Keratinocytes Promotes Self-RNA Sensing by Dendritic Cells in Psoriasis. | ||
Cell Metab Tyrosine Phosphorylation of Mitochondrial Creatine Kinase 1 Enhances a Druggable Tumor Energy Shuttle Pathway. | ||
Nat Cell Biol AIDA directly connects sympathetic innervation to adaptive thermogenesis by UCP1. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jimmy (Verified Customer) (02-27-2024) | Strong signal in primary human cell fractions.
|
FH Maria (Verified Customer) (08-17-2021) | Good ab, works well 1:1000 in BSA 3% O/N 4ºC incubation.
![]() |
FH Mohammed (Verified Customer) (08-19-2020) | Very strong staining in the midpiece of the sperm tail.
|
FH SITING (Verified Customer) (07-13-2020) | THIS IS A GOOD ANTIBODY, CAN SEE CLEAR BAND
![]() |