Collagen Type III Monoclonal antibody

• 

  WB analysis using 68320-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68320-1-Ig (COL3A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 68320-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 68320-1-Ig (COL3A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human rectum using 68320-1-Ig

  human rectum tissue were subjected to SDS PAGE followed by western blot with 68320-1-Ig (COL3A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit large intestine using 68320-1-Ig

  rabbit large intestine tissue were subjected to SDS PAGE followed by western blot with 68320-1-Ig (COL3A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 68320-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 68320-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 68320-1-Ig

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 68320-1-Ig

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 68320-1-Ig

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 68320-1-Ig (COL3A1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 68320-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using COL3A1 antibody (68320-1-Ig, Clone: 3B1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

Collagen Type III Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68320-1-Ig

Clone No.3B1F3

Publications(15)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF, ELISA

Synonyms

COL3, COL3A1, 3B1F3, Collagen alpha 1(III) chain, Collagen alpha-1(III) chain

---

Tested Applications

• Positive WB detected in: pig colon tissue, human placenta tissue, human rectum tissue, rabbit large intestine tissue, rat colon tissue
• Positive IHC detected in: human ovary tumor tissue, human hepatocirrhosis tissue, human placenta tissue, mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IHC: See 4 publications below
• IF: See 1 publications below

Product Information

68320-1-Ig targets Collagen Type III in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4229

  Product name: Recombinant human COL3A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1150-1466 aa of BC028178

  Sequence: DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL

• Full Name: collagen, type III, alpha 1
• Calculated Molecular Weight: 1466 aa, 139 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC028178
• Gene Symbol: COL3A1
• Gene ID (NCBI): 1281
• RRID: AB_2935393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P02461
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Type III collagen is a fibrillar-forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochem Biophys Res Commun; The characterization of the sensitive ovarian cancer cell lines A2780 and W1 in response to ovarian CAFs; Authors - Karolina Wojtowicz
rat	WB	Int J Pharm; Metformin suppressed tendon injury-induced adhesion via hydrogel-nanoparticle sustained-release system; Authors - Zhi Jie Li
mouse	WB	J Transl Med; TNFSF14/LIGHT promotes cardiac fibrosis and atrial fibrillation vulnerability via PI3Kγ/SGK1 pathway-dependent M2 macrophage polarisation; Authors - Yirong Wu
human	IHC	Cancer Biol Ther; Role and mechanism of COL3A1 in regulating the growth, metastasis, and drug sensitivity in cisplatin-resistant non-small cell lung cancer cells; Authors - Jiankun Ren ; KD Validated
human	IF	J Nanobiotechnology; Melt-electrowriting-enabled anisotropic scaffolds loaded with valve interstitial cells for heart valve tissue Engineering; Authors - Chao Xu
human	WB	Mater Today Bio; Silk fibroin microgrooved zirconia surfaces improve connective tissue sealing through mediating glycolysis of fibroblasts; Authors - Yinuo Yan