CNOT8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CNOT8 Polyclonal antibody (10752-1-AP)

• Featured Product
• KD/KO Validated

CNOT8 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10752-1-AP Copied!

Publications (8)

Reviews (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CAF1, CAF1 like protein, Caf1b, CAF1-like protein, CAF2

• 

  WB analysis of Jurkat using 10752-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10752-1-AP (CNOT8 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10752-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10752-1-AP (CNOT8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 10752-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10752-1-AP (CNOT8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 10752-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 10752-1-AP (CNOT8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 10752-1-AP

  IP result of anti-CNOT8 (IP:10752-1-AP, 4ug; Detection:10752-1-AP 1:600) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10752-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10752-1-AP (CNOT8 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 10752-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10752-1-AP (CNOT8 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 10752-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10752-1-AP (CNOT8 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10752-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10752-1-AP (CNOT8 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10752-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10752-1-AP (CNOT8 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10752-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CNOT8 antibody (10752-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CNOT8 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, mouse testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human prostate cancer tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10752-1-AP targets CNOT8 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1201

  Product name: Recombinant human CNOT8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-292 aa of BC017366

  Sequence: MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ

• Full Name: CCR4-NOT transcription complex, subunit 8
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC017366
• Gene Symbol: CNOT8
• Gene ID (NCBI): 9337
• RRID: AB_2082470
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UFF9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCR4-NOT transcription complex subunit 8(CNOT8), is a ubiquitous transcription factor, which required for a diverse set of processes. The CCR4-NOT complex is a global regulator of RNA polymerase II, and functions as general transcription regulation complex. It consisted part by CCR4, NOT1 to NOT5, and CAF1. This is a rabbit polyclonal antibody raised against the full-length chain of human CNOT8.

Publications

What published studies show

The CNOT8 Polyclonal antibody (Cat# 10752-1-AP) has 8 total citations. These appear in journals including Nature Communications, Molecular Cell, Nucleic Acids Research, British Journal of Cancer, Cells, and Molecular Systems. The research fields span RNA biology (mRNA deadenylation, poly(A) tail regulation), CCR4-NOT complex function, transcriptional regulation, gastric cancer progression, genome instability, ER-associated mRNA degradation, and oxygen response pathways.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Commun; Maternal mRNA deadenylation is defective in in vitro matured mouse and human oocytes; Authors - Yusheng Liu
		Nat Commun; MARTRE family proteins negatively regulate CCR4-NOT activity to protect poly(A) tail length and promote translation of maternal mRNA; Authors - Jing Yang
human	WB	Mol Cell; Mechanism of ribosome-associated mRNA degradation during tubulin autoregulation; Authors - Markus Höpfler ; KD Validated
human	WB	Nucleic Acids Res; BESST: a novel LncRNA knockout strategy with less genome perturbance; Authors - Shikuan Zhang
		Br J Cancer; LAMB3 drives gastric cancer progression through SAMD4A-mediated degradation of PHLPP2 mRNA leading to sustained PI3K-Akt activation.; Authors - Jiamei Guo
mouse	WB	Cells; Translation Efficiency and Degradation of ER-Associated mRNAs Modulated by ER-Anchored poly(A)-Specific Ribonuclease (PARN).; Authors - Tian-Li Duan

Reviews

4.6 out of 5

3 verified customer reviews

What customers say

All three reviews are for Western Blot and rate the antibody positively. Users report reliable detection of CNOT8 in HeLa cells at dilutions of 1:500 to 1:1000 with overnight incubation at 4°C. One reviewer noted it performs better than the related CNOT9 antibody. Overall, the antibody is considered effective and consistent across users.

Automatically generated from the 3 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Maria (Verified Customer) (11-09-2025)

It works fine for detecting CNOT8 at 1:1000, overnight at 4 °C.

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: Hela

Aditya (Verified Customer) (10-08-2024)

works okay, better than cnot9

• Applications: Western Blot

Roy (Verified Customer) (06-12-2024)

Works well to detect CNOT8 by Western Blot (1/500 Dilution)

• Applications: Western Blot
• Primary Antibody Dilution: 1/500
• Cell Tissue Type: HeLa