CLPP Monoclonal antibody, PBS Only

• 

  WB analysis of human heart using 66271-1-Ig (same clone as 66271-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 66271-1-Ig (CLPP Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66271-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 66271-1-Ig (same clone as 66271-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 66271-1-Ig (CLPP Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66271-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 66271-1-Ig (same clone as 66271-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 66271-1-Ig (CLPP Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66271-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CLPP Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66271-1-PBS

Clone No.2E1D9

Host / Isotype

Mouse / IgG3

Reactivity

human, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

2E1D9, ATP-dependent Clp protease proteolytic subunit, mitochondrial, EC:3.4.21.92, Endopeptidase Clp

---

Product Information

66271-1-PBS targets CLPP in WB, IHC, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG3
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8420

  Product name: Recombinant human CLPP protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-277 aa of BC002956

  Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

• Full Name: ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 26 kDa, 30 kDa
• GenBank Accession Number: BC002956
• Gene Symbol: CLPP
• Gene ID (NCBI): 8192
• RRID: AB_2881656
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q16740
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. This protein has a transit peptide of 56 amino acid.