• Featured Product
  • KD/KO Validated

CLPP Monoclonal antibody

CLPP Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66271-1-Ig
Clone No.2E1D9

Host / Isotype

Mouse / IgG3

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF, ELISA

2E1D9, ATP-dependent Clp protease proteolytic subunit, mitochondrial, EC:3.4.21.92, Endopeptidase Clp

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman heart tissue, pig heart tissue
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66271-1-Ig targets CLPP in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG3
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8420

Product name: Recombinant human CLPP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-277 aa of BC002956

Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

Predict reactive species
Full Name ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 26 kDa, 30 kDa
GenBank Accession NumberBC002956
Gene Symbol CLPP
Gene ID (NCBI) 8192
RRIDAB_2881656
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16740
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. This protein has a transit peptide of 56 amino acid.

Protocols

Product Specific Protocols
IHC protocol for CLPP antibody 66271-1-IgDownload protocol
WB protocol for CLPP antibody 66271-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

Enhancing mitochondrial proteostasis reduces amyloid-β proteotoxicity.

Authors - Vincenzo Sorrentino
humanIF

Cells

Inactivity of Peptidase ClpP Causes Primary Accumulation of Mitochondrial Disaggregase ClpX with Its Interacting Nucleoid Proteins, and of mtDNA.

Authors - Jana Key
mouseWB

PeerJ

Mitochondrial unfolded protein response gene CLPP changes mitochondrial dynamics and affects mitochondrial function.

Authors - GuiJun Wu
  • KD Validated
humanWB

NeuroImmune Pharm Ther

Resveratrol and its analogs suppress HIV replication, oxidative stress, and inflammation in macrophages

Authors - Santosh Kumar
mouseWB

Front Pharmacol

BAM8-22 targets spinal MrgC receptors to modulate UPRmt activity in the mechanism of bone cancer pain

Authors - Mingming Xie
Loading...
||
New chat Able
正在加载,请稍候...