Tested Applications
| Positive WB detected in | HepG2 cells, Jurkat cells, MCF-7 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26754-1-AP targets CENPA in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25025 Product name: Recombinant human CENPA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC002703 Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH Predict reactive species |
| Full Name | centromere protein A |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16-20 kDa |
| GenBank Accession Number | BC002703 |
| Gene Symbol | CENPA |
| Gene ID (NCBI) | 1058 |
| RRID | AB_2880622 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49450 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Centromere protein-A (CENP-A) is a Histone H3-like protein that contains a C-terminal H3-like domain, required for centro-mere localization of CENP-A, and an antigenic N-terminal domain. CENP-A, originally isolated from HeLa cells, is essential for kinetochore targeting of CENP-C. In the presence of DNA, CENP-A forms an octameric complex with histones H4, H2A and H2B. CENP-A specifically localizes to active centromeres and is a component of specialized centromeric nucleosomes, on which kinetochores are assembled. CENP-A is essential for nucleosomal packaging of centromeric DNA at interphase and functions as a centromere formation marker on the chromosome.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CENPA antibody 26754-1-AP | Download protocol |
| WB protocol for CENPA antibody 26754-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-CENPA antibody (Cat# 26754-1-AP) has 6 total citations published in journals including Proc Natl Acad Sci U S A, Cell Biosci, Transl Oncol, Pathol Res Pract, J Cancer, and Front Genet. Research fields span germ cell differentiation and meiotic progression in reptiles, Drosophila spermatogenesis and germline development, pan-cancer centromere protein landscapes, glioblastoma stemness and ferroptosis, prostate adenocarcinoma biomarkers, and renal clear cell carcinoma immunophenotype regulation. Applications include IF, IHC, and WB.
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A Gonadal sex and temperature independently influence germ cell differentiation and meiotic progression in Trachemys scripta | ||
Cell Biosci Ssrp governs germline development independent of the FACT complex in Drosophila spermatogenesis. | ||
Transl Oncol A pan-cancer landscape of centromere proteins in tumorigenesis and anticancer drug sensitivity | ||
Pathol Res Pract CENPA facilitates glioma stem cell stemness and suppress ferroptosis to accelerate glioblastoma multiforme progression by promoting GBP2 transcription | ||
J Cancer Five-gene signature associating with Gleason score serve as novel biomarkers for identifying early recurring events and contributing to early diagnosis for Prostate Adenocarcinoma. | ||
Front Genet Identification of IGF2BP3 and CENPA as key regulators of immunophenotypes in renal clear cell carcinoma.
|
Reviews
What customers say
One reviewer (Christoffer N.) gave a 5-star rating for Immunofluorescence using lot 00048264 at a 1:100 dilution on adult mouse retina (paraffin embedded) and embryonic E14 mouse retina (cryo embedded). They noted that the cryo-embedded tissue stained better when combined with antigen retrieval using citric buffer.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christoffer (Verified Customer) (03-03-2025) | Adult mouse retina paraffin embedded and Cryo embedded embryonic (E14) mouse. The Cryo embedded tissue stains better with antigen retrieval (citric buffer)
|
