VE-cadherin/CD144 Polyclonal antibody

VE-cadherin/CD144 Polyclonal Antibody for WB, IHC, IF/ICC, FC, ELISA

Cat No. 27956-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC, ELISA

VE-cadherin, Vascular endothelial cadherin, CDH5, CD144, Cadherin 5

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, human placenta tissue
Positive IHC detected inhuman placenta tissue, human breast cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHUVEC cells
Positive FC detected inHUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27956-1-AP targets VE-cadherin/CD144 in WB, IHC, IF/ICC, FC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27487

Product name: Recombinant human CDH5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 54-241 aa of NM_001795

Sequence: MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT

Predict reactive species
Full Name cadherin 5, type 2 (vascular endothelium)
Calculated Molecular Weight 88 kDa
Observed Molecular Weight120-140 kDa
GenBank Accession NumberNM_001795
Gene Symbol VE-cadherin
Gene ID (NCBI) 1003
RRIDAB_2918136
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP33151
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Vascular endothelial cadherin (VE-cadherin), also known as Cadherin-5 (CDH5) or CD144, is a member of the type II classical cadherin family of cell adhesion proteins (PMID: 21269602). VE-cadherin is expressed specifically in endothelial cells and mediates homophilic adhesion in the vascular endothelium (PMID: 1522121; 8555485; 21269602). VE-cadherin plays a role in the organization of lateral endothelial junctions and in the control of permeability properties of vascular endothelium (PMID: 1522121). VE-cadherin has also been shown to be required for angiogenesis (PMID: 16473763; 18162609). The calculated molecular weight of VE-cadherin is 88 kDa and the apparent molecular weight of 120-140 kDa is higher due to post-translational glycosylation and phosphorylation (PMID: 10460833; 29894844). Full-length VE-cadherin can be proteolytically cleaved to generate a fragment of 90-100 kDa (PMID: 9786462; 22064597).

Protocols

Product Specific Protocols
WB protocol for VE-cadherin/CD144 antibody 27956-1-APDownload protocol
IHC protocol for VE-cadherin/CD144 antibody 27956-1-APDownload protocol
IF protocol for VE-cadherin/CD144 antibody 27956-1-APDownload protocol
FC protocol for VE-cadherin/CD144 antibody 27956-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Nat Commun

FNIP1 abrogation promotes functional revascularization of ischemic skeletal muscle by driving macrophage recruitment

Authors - Zongchao Sun
WB

Adv Healthc Mater

Colon-Targeted Ginseng Polysaccharides-Based Microspheres for Improving Ulcerative Colitis via Anti-Inflammation and Gut Microbiota Modulation

Authors - De-Yang Huo
humanIF

Bioengineering (Basel)

Organotypic 3D Co-Culture of Human Pleura as a Novel In Vitro Model of Staphylococcus aureus Infection and Biofilm Development

Authors - Olga Kurow
WB

Pharmaceuticals (Basel)

CXCL8 Promotes Endothelial-to-Mesenchymal Transition of Endothelial Cells and Protects Cells from Erastin-Induced Ferroptosis via CXCR2-Mediated Activation of the NF-κB Signaling Pathway

Authors - Hai-Zhou Ji
WB

World J Diabetes

Tongxinluo promotes endothelium-dependent arteriogenesis to attenuate diabetic peripheral arterial disease

Authors - Jiao-Jiao Gu
WB

Front Cell Infect Microbiol

Analysis of miRNAs Involved in Mouse Heart Injury Upon Coxsackievirus A2 Infection.

Authors - Zhaoke Wu
Loading...