VE-cadherin/CD144 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• VE-cadherin/CD144 Polyclonal antibody (27956-1-AP)

VE-cadherin/CD144 Polyclonal Antibody for WB, IHC, IF/ICC, FC, ELISA

Cat No. 27956-1-AP

Publications(48)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC, ELISA

Synonyms

VE-cadherin, 7B4, 7B4 antigen, Cadherin 5, Cadherin-5

• 

  WB analysis using 27956-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27956-1-AP (VE-cadherin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27956-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27956-1-AP (VE-cadherin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27956-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27956-1-AP (VE-cadherin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 27956-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27956-1-AP (CDH5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 27956-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 27956-1-AP (CDH5 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 27956-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27956-1-AP (VE-cadherin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 27956-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27956-1-AP (VE-cadherin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HUVEC using 27956-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using VE-cadherin/CD144 antibody (27956-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HUVEC using 27956-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using VE-cadherin/CD144 antibody (27956-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HUVEC using 27956-1-AP

  1X10^6 HUVEC cells were surface stained with 0.4 ug Anti-Human VE-cadherin (27956-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000, or 0.4 ug Control Antibody. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HUVEC cells, human placenta tissue
• Positive IHC detected in: human placenta tissue, human breast cancer tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HUVEC cells
• Positive FC detected in: HUVEC cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27956-1-AP targets VE-cadherin/CD144 in WB, IHC, IF/ICC, FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27487

  Product name: Recombinant human CDH5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 54-241 aa of NM_001795

  Sequence: MHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGT

• Full Name: cadherin 5, type 2 (vascular endothelium)
• Calculated Molecular Weight: 88 kDa
• Observed Molecular Weight: 120-140 kDa
• GenBank Accession Number: NM_001795
• Gene Symbol: VE-cadherin
• Gene ID (NCBI): 1003
• RRID: AB_2918136
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P33151
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cadherins are a family of transmembrane glycoproteins that mediate calcium-dependent cell-cell adhesion and play an important role in the maintenance of normal tissue architecture. Vascular endothelial cadherin (VE-cadherin), also known as Cadherin-5 (CDH5) or CD144, is a member of the type II classical cadherin family of cell adhesion proteins (PMID: 21269602). VE-cadherin is expressed specifically in endothelial cells and mediates homophilic adhesion in the vascular endothelium (PMID: 1522121; 8555485; 21269602). VE-cadherin plays a role in the organization of lateral endothelial junctions and in the control of permeability properties of vascular endothelium (PMID: 1522121). VE-cadherin has also been shown to be required for angiogenesis (PMID: 16473763; 18162609). The calculated molecular weight of VE-cadherin is 88 kDa and the apparent molecular weight of 120-140 kDa is higher due to post-translational glycosylation and phosphorylation (PMID: 10460833; 29894844). Full-length VE-cadherin can be proteolytically cleaved to generate a fragment of 90-100 kDa (PMID: 9786462; 22064597).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Circulation; Aberrant Phase Separation of Endothelial MAML1 Causes Congenital Heart Disease by Suppressing Notch Activity; Authors - Zizheng Tan
		Adv Mater; Engineered MSCs Break Endothelial-Myofibroblast Crosstalk in Pulmonary Fibrosis: Reconstructing the Vascular Niche; Authors - Yue-Fei Fang
	WB	Nat Commun; FNIP1 abrogation promotes functional revascularization of ischemic skeletal muscle by driving macrophage recruitment; Authors - Zongchao Sun
	WB	ACS Nano; Static Topographical Cue Combined with Dynamic Fluid Stimulation Enhances the Macrophage Extracellular Vesicle Yield and Therapeutic Potential for Bone Defects; Authors - Huayi Huang
	IF	J Nanobiotechnology; Synergistic dual cell therapy for atherosclerosis regression: ROS-responsive Bio-liposomes co-loaded with Geniposide and Emodin; Authors - Zhenxian Li
	WB	J Nanobiotechnology; Platelet-rich plasma-derived extracellular vesicles delivered niraparib for ultrasound imaging and atherosclerosis treatment.; Authors - Weimin Fang