CD90 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CD90 Monoclonal antibody (66766-1-Ig)

CD90 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66766-1-Ig Copied!

Clone No. 2D7D11

Publications (71)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

CD90 / Thy1, THY1, 2D7D11, Thy 1 antigen, Thy 1 cell surface antigen

• 

  WB analysis using 66766-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66766-1-Ig (CD90 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig colon using 66766-1-Ig

  pig colon tissue were subjected to SDS PAGE followed by western blot with 66766-1-Ig (CD90 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rabbit brain using 66766-1-Ig

  rabbit brain tissue were subjected to SDS PAGE followed by western blot with 66766-1-Ig (CD90 antibody) at dilution of 1:9700 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of U2OS using 66766-1-Ig

  U2OS cells were subjected to SDS PAGE followed by western blot with 66766-1-Ig (CD90 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of fetal human brain using 66766-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66766-1-Ig (CD90 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human kidney using 66766-1-Ig

  human kidney tissue were subjected to SDS PAGE followed by western blot with 66766-1-Ig (CD90 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig brain using 66766-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 66766-1-Ig (CD90 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig spleen using 66766-1-Ig

  pig spleen tissue were subjected to SDS PAGE followed by western blot with 66766-1-Ig (CD90 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:3900 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:1000 (under 4x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:3900 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:3900 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:3900 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66766-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66766-1-Ig (CD90 antibody) at dilution of 1:3900 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 66766-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using 66766-1-Ig (CD90 antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 66766-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using 66766-1-Ig (CD90 antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD90 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, rabbit brain tissue, U2OS cells, human kidney tissue, pig brain tissue, pig spleen tissue, pig colon tissue
• Positive IHC detected in: human tonsillitis tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66766-1-Ig targets CD90 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Cited Reactivity: human, mouse, rat, pig, rabbit, bovine
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25603

  Product name: Recombinant human CD90 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-80 aa of BC065559

  Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF

• Full Name: Thy-1 cell surface antigen
• Calculated Molecular Weight: 161 aa, 18 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC065559
• Gene Symbol: CD90/Thy1
• Gene ID (NCBI): 7070
• RRID: AB_2882112
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04216
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.

Publications

What published studies show

CD90 Monoclonal antibody (2D7D11), catalog number 66766-1-Ig, has 71 citations spanning over 50 journals, including Nature Communications, Advanced Science, Journal of Controlled Release, Molecular Therapy, International Journal of Biological Sciences, and Cells. Research fields cover stem cell biology, tissue engineering, cartilage and bone regeneration, rheumatoid arthritis, cancer (hepatocellular, breast, pancreatic), fibrosis, cardiovascular disease, neuroinflammation, wound healing, and immunology.

Automatically generated from the 71 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human, mouse	IHC	Nat Commun; CD142-positive synovial fibroblasts drive meniscus destruction in rheumatoid arthritis; Authors - Hao Sun
rat	IF	Nat Commun; Streamlined metal-based hydrogel facilitates stem cell differentiation, extracellular matrix homeostasis and cartilage repair in male rats; Authors - Wen Li
human	IF	Nat Commun; Dynamically cultured, differentiated bovine adipose-derived stem cell spheroids as building blocks for biofabricating cultured fat; Authors - Annemarie Klatt
rat	IF	J Nanobiotechnology; All-in-one smart dressing for simultaneous angiogenesis and neural regeneration; Authors - Tiejun Yuan
		Adv Sci (Weinh); Cerium Nanoparticle-Mediated Inhibition of the NSUN2/m(5)C Axis Suppresses Synovial Aggression in Rheumatoid Arthritis.; Authors - Ruiru Li
mouse	IF	Adv Sci (Weinh); Sleep Deprivation Aggravates Periodontitis Through Trigeminal-Periodontal Neuroimmune Pathway Mediated by the AChE-ACh-α7nAChR Axis.; Authors - Kehao Liu