CD7 Monoclonal antibody

• 

  WB analysis of Jurkat using 60209-2-Ig

  Untreated and PNGase F-treated lysates of Jurkat cells were subjected to SDS PAGE followed by western blot with 60209-2-Ig (CD7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808).

• 

  WB analysis using 60209-2-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60209-2-Ig (CD7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse thymus using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse thymus using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lymphoma using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 60209-2-Ig(CD7 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lymphoma using 60209-2-Ig

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 60209-2-Ig(CD7 antibody) at dilution of 1:50 (under 40x lens).

CD7 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60209-2-Ig

Clone No.2A4E6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

2A4E6, CD7 molecule, GP40, LEU-9, T cell antigen CD7

---

Tested Applications

• Positive WB detected in: Jurkat cells, HepG2 cells, HuH-7 cells, MOLT-4 cells
• Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human lymphoma tissue, mouse thymus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60209-2-Ig targets CD7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1805

  Product name: Recombinant human CD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-240 aa of BC009293

  Sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ

• Full Name: CD7 molecule
• Calculated Molecular Weight: 240 aa, 25 kDa
• Observed Molecular Weight: 34-36 kDa
• GenBank Accession Number: BC009293
• Gene Symbol: CD7
• Gene ID (NCBI): 924
• ENSEMBL Gene ID: ENSG00000173762
• RRID: AB_2881355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P09564
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512).