Tested Applications
| Positive WB detected in | U-937 cells, pig thymus tissue, mouse thymus tissue |
| Positive IP detected in | mouse thymus tissue |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 10 publications below |
Product Information
19068-1-AP targets CD4 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13616 Product name: Recombinant human CD4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 419-458 aa of BC025782 Sequence: CVRCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI Predict reactive species |
| Full Name | CD4 molecule |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | BC025782 |
| Gene Symbol | CD4 |
| Gene ID (NCBI) | 920 |
| ENSEMBL Gene ID | ENSG00000010610 |
| RRID | AB_10603357 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01730 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD4 is a 55-kDa transmembrane glycoprotein expressed on T helper cells, majority of thymocytes, monocytes, macrophages, and dendritic cells. CD4 is an accessory protein for MHC class-II antigen/T-cell receptor interaction. It plays an important role in T helper cell development and activation. CD4 serves as a receptor for the human immunodeficiency virus (HIV).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD4 antibody 19068-1-AP | Download protocol |
| IP protocol for CD4 antibody 19068-1-AP | Download protocol |
| WB protocol for CD4 antibody 19068-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gut Microbes Synergistic activity of Enterococcus Faecium-induced ferroptosis via expansion of IFN-γ+CD8+ T cell population in advanced hepatocellular carcinoma treated with sorafenib | ||
ACS Appl Mater Interfaces Fe(III)-Chelated Polydopamine Nanoparticles for Synergistic Tumor Therapies of Enhanced Photothermal Ablation and Antitumor Immune Activation. | ||
J Control Release Cancer-cell-biomimetic Upconversion nanoparticles combining chemo-photodynamic therapy and CD73 blockade for metastatic triple-negative breast cancer. | ||
J Hematol Oncol PD-1 axis expression in musculoskeletal tumors and antitumor effect of nivolumab in osteosarcoma model of humanized mouse. | ||
Int J Mol Sci Human Milk Oligosaccharide 2'-Fucosyllactose Induces Neuroprotection from Intracerebral Hemorrhage Stroke. | ||
Exp Neurol Calpain mediated expansion of CD4+ cytotoxic T cells in rodent models of Parkinson's disease. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Shriya (Verified Customer) (09-21-2025) | Cd4 polyclonal antibody.
|
FH Nicole (Verified Customer) (04-28-2022) | no signal expression is controlled by other antibodies
|









