• Featured Product
  • KD/KO Validated

CD3 Polyclonal antibody

CD3 Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, ELISA
Cat No. 17617-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, IF-Fro, IP, ELISA, Cell treatment

CD3E, CD3 epsilon, CD3-epsilon, T3E, T-cell surface antigen T3/Leu-4 epsilon chain

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, pig spleen tissue, MOLT-4 cells, mouse thymus tissue, rat thymus tissue
Positive IP detected inJurkat cells
Positive IHC detected inhuman tonsillitis tissue, mouse spleen tissue, human lymphoma tissue, human lung cancer tissue, human breast cancer tissue, mouse colon tissue, human pancreas cancer tissue, rat thymus tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue, mouse spleen tissue
Positive IF-Fro detected inmouse colon tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17617-1-AP targets CD3 in WB, IHC, IF-P, IF-Fro, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11797

Product name: Recombinant human CD3E protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-207 aa of BC049847

Sequence: MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Predict reactive species
Full Name CD3e molecule, epsilon (CD3-TCR complex)
Calculated Molecular Weight 207 aa, 23 kDa
Observed Molecular Weight 23-25 kDa
GenBank Accession NumberBC049847
Gene Symbol CD3
Gene ID (NCBI) 916
ENSEMBL Gene IDENSG00000198851
RRIDAB_1939430
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP07766
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR/CD3 complex of T-lymphocytes consists of either a TCR alpha/beta or TCR gamma/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. This anti-CD3 is a polyclonal antibody directed against the epsilon chain of human CD3 molecule.

Protocols

Product Specific Protocols
WB protocol for CD3 antibody 17617-1-APDownload protocol
IHC protocol for CD3 antibody 17617-1-APDownload protocol
IF protocol for CD3 antibody 17617-1-APDownload protocol
IP protocol for CD3 antibody 17617-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
pigIF

Nature

Injectable ultrasonic sensor for wireless monitoring of intracranial signals

Authors - Hanchuan Tang
humanIHC

Blood

C1Q labels a highly aggressive macrophage-like leukemia population indicating extramedullary infiltration and relapse

Authors - Li-Xue Yang
humanIHC

Nat Commun

Engineered triple inhibitory receptor resistance improves anti-tumor CAR-T cell performance via CD56.

Authors - Fan Zou
ratIHC

J Adv Res

Zearalenone-14-glucoside specifically promotes dysplasia of Gut-Associated Lymphoid Tissue: A natural product for constructing intestinal nodular lymphatic hyperplasia model

Authors - Haonan Ruan
humanIHC

Cancer Res

M6A Demethylase ALKBH5 Regulates PD-L1 Expression and Tumor Immunoenvironment in Intrahepatic Cholangiocarcinoma.

Authors - Xinyao Qiu

Acta Biomater

Simultaneous targeting of TGF-β1/PD-L1 via a hydrogel-nanoparticle system to remodel the ECM and immune microenvironment for limiting adhesion formation

Authors - Qian Qian Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Federica (Verified Customer) (12-08-2023)

Leica Bond RXm Red Chromogenic Kit Antigen Retrival ER1 (ph6) for 30 min

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: Tonsil
CD3 Antibody Immunohistochemistry validation (1:400 dilution) in Tonsil (Cat no:17617-1-AP)
FH

Niklas (Verified Customer) (07-31-2023)

works well

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: human heart
FH

Emma (Verified Customer) (11-29-2021)

This works really well by IF on FFPE tissue. We used a 1:50 dilution and Tris-EDTA antigen retrieval.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Prostate
CD3 Antibody Immunofluorescence validation (1:50 dilution) in Prostate (Cat no:17617-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...