Tested Applications
Positive WB detected in | K-562 cells, U-937 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25323-1-AP targets CD32A/C in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18123 Product name: Recombinant human FCGR2C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 254-323 aa of BC137397 Sequence: ANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN Predict reactive species |
Full Name | Fc fragment of IgG, low affinity IIc, receptor for (CD32) |
Calculated Molecular Weight | 323 aa, 36 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC137397 |
Gene Symbol | CD32A/C |
Gene ID (NCBI) | 9103 |
RRID | AB_3085785 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P31995 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IgG Fc receptors (FcγRs) play important roles in immune responses. The low-affinity IgG Fc receptor, FcγRII (CD32), consists of a family of primarily cell membrane receptor proteins: CD32A, CD32B, and CD32C. They are encoded by the mRNA splice variants of three highly related genes: FCGR2A, FCGR2B, and FCGR2C (PMID: 30941127). CD32 is present on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. This antibody raised against 254-323 aa of human CD32C (FCGR2C) can recognize both CD32A and CD32C forms.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CD32A/C antibody 25323-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |