CD31 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 66065-2-Ig (same clone as 66065-2-PBS)

  Untreated and PNGase F-treated lysates of human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human peripheral blood platelets using 66065-2-Ig (same clone as 66065-2-PBS)

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 66065-2-Ig (same clone as 66065-2-PBS)

  Untreated and PNGase F-treated lysates of Jurkat cells were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66065-2-Ig (same clone as 66065-2-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 66065-2-Ig (same clone as 66065-2-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 66065-2-Ig (CD31 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:10000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66065-2-Ig (CD31 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IF Staining of human placenta using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human placenta tissue using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HUVEC using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HUVEC cells using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HUVEC using 66065-2-Ig (same clone as 66065-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HUVEC cells using CD31 antibody (66065-2-Ig, Clone: 3F8E2 ) at dilution of 1:2000 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002), Beta Tubulin antibody (80713-1-RR, Clone: 2O13, red). This data was developed using the same antibody clone with 66065-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50319-2

  Cytometric bead array standard curve of MP50319-2, CD31 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66065-2-PBS. Detection antibody: 66065-5-PBS. Standard:Ag1787. Range: 3.125-200 ng/mL.

CD31 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 66065-2-PBS

Clone No.3F8E2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

PECAM 1, PECA1, GPIIA', GPIIA, EndoCAM

---

Product Information

66065-2-PBS targets CD31 as part of a matched antibody pair:

MP50319-2: 66065-2-PBS capture and 66065-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19730

  Product name: Recombinant human CD31 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 428-738 aa of BC022512

  Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT

• Full Name: platelet/endothelial cell adhesion molecule
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC022512
• Gene Symbol: CD31
• Gene ID (NCBI): 5175
• ENSEMBL Gene ID: ENSG00000261371
• RRID: AB_2918476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P16284
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).