CD24 Monoclonal antibody

• 

  WB analysis using 67627-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67627-1-Ig (CD24 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Daudi using 67627-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Daudi cells using CD24 antibody (67627-1-Ig, Clone: 1H5C4 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002).

CD24 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67627-1-Ig

Clone No.1H5C4

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

1H5C4, CD24A

---

Tested Applications

• Positive WB detected in: MCF-7 cells, Raji cells, Ramos cells, Daudi cells, Jurkat cells, K-562 cells, HL-60 cells
• Positive IF/ICC detected in: Daudi cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

67627-1-Ig targets CD24 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11679

  Product name: Recombinant human CD24 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-80 aa of BC007674

  Sequence: MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS

• Full Name: CD24 molecule
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC007674
• Gene Symbol: CD24
• Gene ID (NCBI): 100133941
• RRID: AB_2882828
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P25063
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD24 (known as heat stable antigen) is a small highly glycosylated GPI-linked sialoprotein. It is normally expressed at the surface of most B lymphocytes and differentiating neuroblasts, and it is also up-regulated in a wide variety of cancers. Studies have shown that CD24 functions in the regulation of B-cell apoptosis, leukocyte signal transduction, and leukocyte adhesion. Since it is highly glycosylated, the apparent molecular weight of CD24 could be variable, ranging from 30 kDa to 70 kDa. (Ref: Akihiko Sano, MD., 2009)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Breast Cancer (Dove Med Press); CD24 May Serve as an Immunotherapy Target in Triple-Negative Breast Cancer by Regulating the Expression of PD-L1; Authors - Xudong Zhu
human	WB	Biomedicines; Development of LncRNA Biomarkers in Extracellular Vesicle of Amniotic Fluid Associated with Antenatal Hydronephrosis; Authors - Ying Fu
human	WB	Oncogene; A positive feedback loop of OTUD1 and c-Jun driven by leptin expedites stemness maintenance in ovarian cancer; Authors - Jingtao Wang