CD16 Polyclonal antibody

• 

  IHC staining of human placenta using 16559-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16559-1-AP (CD16 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human placenta using 16559-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 16559-1-AP (CD16 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16559-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16559-1-AP (CD16 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 16559-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16559-1-AP (CD16 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human tonsillitis using 16559-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16559-1-AP (CD16 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 16559-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16559-1-AP (CD16 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of human liver cancer using 16559-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CD16 antibody (16559-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

CD16 Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 16559-1-AP

Publications(47)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

IHC, IF-P, ELISA

Synonyms

Fc gamma RIIIa, Fc gamma RIII alpha, Fc gamma RIII, CD16-II, CD16a antigen

---

Tested Applications

• Positive IHC detected in: human liver tissue, human placenta tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human liver cancer tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 9 publications below
• IF: See 27 publications below
• FC: See 1 publications below

Product Information

16559-1-AP targets CD16 in IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9787

  Product name: Recombinant human CD16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-254 aa of BC017865

  Sequence: FLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK

• Full Name: Fc fragment of IgG, low affinity IIIa, receptor (CD16a)
• Calculated Molecular Weight: 254 aa, 29 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC017865
• Gene Symbol: CD16a
• Gene ID (NCBI): 2214
• ENSEMBL Gene ID: ENSG00000203747
• RRID: AB_2878279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08637
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD16 is a 50-70-kDa low affinity Fc receptor found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16 mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis. CD16 has been identified as Fc receptors FcγRIIIa (CD16a) and FcγRIIIb (CD16b), encoded by two nearly identical genes, FCGR3A and the FCGR3B.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Adv Sci (Weinh); S100A5 Attenuates Efficiency of Anti-PD-L1/PD-1 Immunotherapy by Inhibiting CD8+ T Cell-Mediated Anti-Cancer Immunity in Bladder Carcinoma; Authors - Huihuang Li
human	IF	J Immunother Cancer; Discovery of a glucocorticoid receptor (GR) activity signature correlates with immune cell infiltration in adrenocortical carcinoma; Authors - Kan Wu
human	WB	J Allergy Clin Immunol; Thymic stromal lymphopoietin epigenetically upregulates Fc receptor γ subunit-related receptors on antigen-presenting cells and induces TH2/TH17 polarization through dectin-2.; Authors - Yunsheng Liang
mouse		Alzheimers Res Ther; Circular RNA APP contributes to Alzheimer's disease pathogenesis by modulating microglial polarization via miR-1906/CLIC1 axis; Authors - Deng-Pan Wu
rat	IF	Theranostics; Effects of prenatal photobiomodulation treatment on neonatal hypoxic ischemia in rat offspring.; Authors - Luodan Yang
rat	WB,IF	Theranostics; Non-invasive photobiomodulation treatment in an Alzheimer Disease-like transgenic rat model.; Authors - Luodan Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Emma (Verified Customer) (11-29-2021)

Works well by IF on FFPE tissue. Antigen retrieval Tris-EDTA pH9.0.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Prostate