Cyclin B2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cyclin B2 Polyclonal antibody (21644-1-AP)

• Featured Product
• KD/KO Validated

Cyclin B2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 21644-1-AP

Publications(40)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CCNB2, cyclin B2, G2/mitotic specific cyclin B2, HsT17299

• 

  WB analysis using 21644-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21644-1-AP (Cyclin B2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 21644-1-AP

  WB result of Cyclin B2 antibody (21644-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Cyclin B2 transfected A431 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 21644-1-AP

  Non-treated HeLa and thymidine or nocodazole treated HeLa cells were subjected to SDS PAGE followed by western blot with 21644-1-AP (Cyclin B2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. The membrane was stripped and re-blotted with GAPDH antibody as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of DU 145 using 21644-1-AP

  DU 145 cells were subjected to SDS PAGE followed by western blot with 21644-1-AP (Cyclin B2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 21644-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 21644-1-AP (Cyclin B2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21644-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21644-1-AP (Cyclin B2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of A431 using 21644-1-AP

  IP result of anti-Cyclin B2 (IP:21644-1-AP, 4ug; Detection:21644-1-AP 1:1000) with A431 cells lysate 2000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 21644-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 21644-1-AP (Cyclin B2 antibody at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 21644-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 21644-1-AP (Cyclin B2 antibody at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 21644-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21644-1-AP (Cyclin B2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 21644-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 21644-1-AP (Cyclin B2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 21644-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 21644-1-AP (Cyclin B2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 21644-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 21644-1-AP (Cyclin B2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A431 cells, DU 145 cells, rat testis tissue, HeLa cells, K-562 cells
• Positive IP detected in: A431 cells
• Positive IHC detected in: human cervical cancer tissue, human testis tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21644-1-AP targets Cyclin B2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16329

  Product name: Recombinant human CCNB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-243 aa of BC105086

  Sequence: MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTS

• Full Name: cyclin B2
• Calculated Molecular Weight: 398 aa, 45 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC105086
• Gene Symbol: Cyclin B2
• Gene ID (NCBI): 9133
• RRID: AB_10755304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95067
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin B2 (CCNB2) is a member of cyclin family proteins, which regulate the activities of cyclin dependent kinases (CDKs) and different cyclins function spatially and temporally in specific phases of the cell cycle. Cyclin B2 serves a key role in progression of G2/M transition. Cyclin B2 has been found to be up-regulated in a variety of human cancers, such as adrenocortical carcinoma, breast carcinoma, colorectal adenocarcinoma, pituitary adenoma and gastric cancer. The aberrant expression of Cyclin B2 deregulates spindle checkpoints in the cell cycle and results in chromosomal instability (CIN), one of the signature phenotypes of most cancers. Moreover, serum circulating Cyclin B2 mRNA expression has been found increased in cancer patients and associated with cancer stage and metastasis status. Cyclin B2 can be detected double bands (PMID:1651338).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; ALG3 contributes to stemness and radioresistance through regulating glycosylation of TGF-β receptor II in breast cancer.; Authors - Xiaoqing Sun
mouse	WB	Adv Sci (Weinh); m6A Reader hnRNPA2B1 Modulates Late Pachytene Progression in Male Meiosis Through Post-Transcriptional Control; Authors - Lisha Yin
human	WB	Cancer Lett; Evaluation of glucocorticoid-related genes reveals GPD1 as a therapeutic target and regulator of sphingosine 1-phosphate metabolism in CRPC; Authors - Ren Liu
mouse	WB	Phytomedicine; Epigallocatechin gallate suppresses mitotic clonal expansion and adipogenic differentiation of preadipocytes through impeding JAK2/STAT3-mediated transcriptional cascades; Authors - He Peng
mouse	WB	Phytomedicine; Ganoderma lucidum polysaccharide inhibits HSC activation and liver fibrosis via targeting inflammation, apoptosis, cell cycle, and ECM-receptor interaction mediated by TGF-β/Smad signaling; Authors - Chaojie Chen
human	WB	Phytomedicine; Revealing active components and action mechanism of Fritillariae Bulbus against non-small cell lung cancer through spectrum-effect relationship and proteomics; Authors - Feng-Jie Liu