CBS Polyclonal antibody

• 

  WB analysis using 14787-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14787-1-AP (CBS antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCI-H1299 using 14787-1-AP

  WB result of CBS antibody (14787-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CBS transfected NCI-H1299 cells.

• 

  WB analysis using 14787-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14787-1-AP (CBS antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 14787-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 14787-1-AP (CBS Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat liver using 14787-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 14787-1-AP (CBS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 14787-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 14787-1-AP (CBS Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat kidney using 14787-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 14787-1-AP (CBS Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse kidney using 14787-1-AP

  IP result of anti-CBS (IP:14787-1-AP, 3ug; Detection:14787-1-AP 1:500) with mouse kidney tissue lysate 4000ug.

• 

  IHC staining of human pancreas cancer using 14787-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14787-1-AP (CBS Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 14787-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 14787-1-AP (CBS Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 14787-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 14787-1-AP (CBS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 14787-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14787-1-AP (CBS antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human pancreas cancer using 14787-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 14787-1-AP (CBS antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of human colon using 14787-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 14787-1-AP (CBS Antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of HeLa using 14787-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CBS antibody (14787-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

CBS Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14787-1-AP

Publications(133)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Beta thionase, Beta-thionase, cystathionine beta synthase, Cystathionine beta-synthase, EC:4.2.1.22

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse colon tissue, NCI-H1299 cells, rat brain tissue, rat kidney tissue, rat liver tissue, HepG2 cells, LNCaP cells, MCF-7 cells, SKOV-3 cells, THP-1 cells, mouse kidney tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: human pancreas cancer tissue, human colon tissue, mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 114 publications below
• IHC: See 24 publications below
• IF: See 19 publications below

Product Information

14787-1-AP targets CBS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, rabbit, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6437

  Product name: Recombinant human CBS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 206-551 aa of BC000440

  Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

• Full Name: cystathionine-beta-synthase
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 61-63 kDa
• GenBank Accession Number: BC000440
• Gene Symbol: CBS
• Gene ID (NCBI): 875
• RRID: AB_2070970
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P35520
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; mTORC1 stimulates cell growth through SAM synthesis and m6A mRNA-dependent control of protein synthesis.; Authors - Elodie Villa
human	IF	Mol Cell; Spatiotemporal Proteomic Analysis of Stress Granule Disassembly Using APEX Reveals Regulation by SUMOylation and Links to ALS Pathogenesis.; Authors - Hagai Marmor-Kollet
canine	IF	Nat Commun; Remote ischemic conditioning counteracts the intestinal damage of necrotizing enterocolitis by improving intestinal microcirculation.; Authors - Yuhki Koike
mouse	WB,IHC,IF	Redox Biol; Endogenous hydrogen sulfide accelerated trauma-induced heterotopic ossification through the Ca2+/ERK pathway-enhanced aberrant osteogenic activity; Authors - Zhengqiang Yuan
human	WB	Cancer Res; PRMT1 sustains de novo fatty acid synthesis by methylating PHGDH to drive chemoresistance in triple-negative breast cancer; Authors - Takehiro Yamamoto
mouse	WB,IF	Redox Biol; Endogenous H2S targets mitochondria to promote continual phagocytosis of erythrocytes by microglia after intracerebral hemorrhage; Authors - Xiaoling Yan