Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Caveolin-1 Monoclonal antibody

Caveolin-1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66067-1-Ig
Clone No. 6C2B2
Publications (34)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (4)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA
For FC, select conjugated version.

CAV1, Caveolin 1, 6C2B2, BSCL3, CAV

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Caveolin-1 in ?

Tested Applications

Positive WB detected inA549 cells, HeLa cells, A431 cells, PC-3 cells, human heart tissue, pig heart tissue, Rat heart tissue, mouse heart tissue
Positive IHC detected inhuman ovary tumor tissue, human breast cancer tissue, human liver tissue, human ovary cancer tissue, human placenta tissue, human tonsillitis tissue, human lung tissue, human appendicitis tissue, human stomach cancer tissue, human spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver cancer tissue, mouse kidney tissue, human skin cancer tissue
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:50000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66067-1-Ig targets Caveolin-1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, canine, monkey, chicken, sheep
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8049

Product name: Recombinant human Caveolin-1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 11-179 aa of BC006432

Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Predict reactive species
Full Name caveolin 1, caveolae protein, 22kDa
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 20-25 kDa
GenBank Accession NumberBC006432
Gene Symbol CAV1
Gene ID (NCBI) 857
RRIDAB_11043343
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ03135
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030).

Protocols

Product Specific Protocols
IF protocol for Caveolin-1 antibody 66067-1-IgDownload protocol
IHC protocol for Caveolin-1 antibody 66067-1-IgDownload protocol
WB protocol for Caveolin-1 antibody 66067-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-Caveolin-1 antibody (Cat# 66067-1-Ig) has 34 citations spanning journals including Cancer Research, Nature Communications, Advanced Science, Cell Death & Disease, FASEB Journal, FEBS Journal, Metabolism, and Veterinary Microbiology. Research fields cover oncology (liver, pancreatic, breast, stomach cancers), metabolism (ferroptosis, insulin resistance, obesity), cardiovascular biology, neurology (Alzheimer's, stroke), renal injury, gastrointestinal barrier function, immunology, and veterinary medicine. Applications include WB, IF, IHC, and IP across human, mouse, rat, pig, chicken, and sheep species.

SpeciesApplicationTitle
humanIF

Cancer Res

Inhibition of EGFR Overcomes Acquired Lenvatinib Resistance Driven by STAT3-ABCB1 Signaling in Hepatocellular Carcinoma

Authors - Beiyuan Hu
humanIF

Nat Commun

Endothelial discoidin domain receptor 1 senses flow to modulate YAP activation

Authors - Jiayu Liu

Metabolism

Endothelial NPR-C promotes insulin resistance via Caveolin-1-mediated insulin transcytosis.

Authors - Zi-Qi Xu
mouseWB

Redox Biol

TrxR1 is involved in the activation of Caspase-11 by regulating the oxidative-reductive status of Trx-1

Authors - Dongsheng Bai
mouseIHC,IF

Adv Sci (Weinh)

Caveolin-1 Stabilizes SERCA2 to Counteract Acute Kidney Injury via Suppression of Ca(2+)-Dependent Endoplasmic Reticulum Stress in Distal Tubules.

Authors - Yan Zhang
  • KO Validated
humanIHC

Cell Death Dis

The methionine salvage pathway-involving ADI1 inhibits hepatoma growth by epigenetically altering genes expression via elevating S-adenosylmethionine.

Authors - Yu-De Chu
Loading...
||
New chat

Able™

正在加载,请稍候...