Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, NIH/3T3 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human breast cancer tissue, human lung tissue, human heart tissue, human liver tissue, human lung cancer tissue, mouse brain tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 14 publications below |
| WB | See 89 publications below |
| IHC | See 18 publications below |
| IF | See 25 publications below |
| IP | See 4 publications below |
| CoIP | See 2 publications below |
Product Information
16447-1-AP targets Caveolin-1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, canine, monkey, zebrafish, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species |
| Full Name | caveolin 1, caveolae protein, 22kDa |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 20-25 kDa |
| GenBank Accession Number | BC006432 |
| Gene Symbol | CAV1 |
| Gene ID (NCBI) | 857 |
| RRID | AB_10732595 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03135 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in astric Cancer (PMID: 25339030). MW of Caveolin-1 is from 20-25 kDa due to phosphorylation (PMID: 10198051).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Caveolin-1 antibody 16447-1-AP | Download protocol |
| IP protocol for Caveolin-1 antibody 16447-1-AP | Download protocol |
| WB protocol for Caveolin-1 antibody 16447-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res Nucleosomes enter cells by clathrin- and caveolin-dependent endocytosis. | ||
Dev Cell Vangl2 limits chaperone-mediated autophagy to balance osteogenic differentiation in mesenchymal stem cells. | ||
Redox Biol Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis | ||
Biomaterials Combination antitumor immunotherapy with VEGF and PIGF siRNA via systemic delivery of multi-functionalized nanoparticles to tumor-associated macrophages and breast cancer cells. | ||
Small Smart Carbon Nanotubes with Laser-Controlled Behavior in Gene Delivery and Therapy through a Non-Digestive Trafficking Pathway. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sammy (Verified Customer) (01-20-2024) | Excellent antibody for use by western blotting. Diluted in 3% BSA PBST.
![]() |
FH Priya (Verified Customer) (06-21-2023) | Used this antibody for Caco2 cells andmice tissue
|
FH Priya (Verified Customer) (06-21-2023) | Used this antibody for Caco2 cells andmice tissue
|
FH Priya (Verified Customer) (04-17-2023) | Used for Caco2 cells
|
FH Priya (Verified Customer) (04-17-2023) | Used for Caco2 cells
|
FH Emma (Verified Customer) (03-15-2022) | Works really well @ 1:1000 for WB in PC3 and DU145 cells. Single band seen.
|
FH Kushal (Verified Customer) (08-09-2021) | We tried to use the antibody at high concentrations of 1:100, yet we do not get bands in our blots.
|
































