CAMP Recombinant monoclonal antibody

• 

  WB analysis of human saliva using 82940-1-RR

  human saliva were subjected to SDS PAGE followed by western blot with 82940-1-RR (CAMP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 82940-1-RR

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 82940-1-RR (CAMP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  Affinity and Kinetic Characterization of 82940-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82940-1-RR against Human ADAMDEC1 were performed. The affinity constant is 98.4 pM.

CAMP Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 82940-1-RR

Clone No.230157B4

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, ELISA

Synonyms

CAP18, 230157B4, Antibacterial peptide FALL-39, Antibacterial peptide FF-33, Antibacterial peptide KR-20

---

Tested Applications

• Positive WB detected in: human saliva, mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

82940-1-RR targets CAMP in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2622

  Product name: Recombinant human CAMP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC055089

  Sequence: MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

• Full Name: cathelicidin antimicrobial peptide
• Calculated Molecular Weight: 170 aa, 19 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC055089
• Gene Symbol: CAMP
• Gene ID (NCBI): 820
• RRID: AB_3670682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49913
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CAMP is a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. CAMP encodes the 18-kDa proprotein hCAP18. FALL-39 and LL-37 are the mature cathelicidin peptides. This antibody can recognize all the proprotein and cleaved species.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	J Ethnopharmacol; Study on the underlying mechanism of Huachansu Capsule induced cardiotoxicity of normal rat by integrating transcriptomics, metabolomics and network toxicology; Authors - Qiang-Qiang Fan
rat		J Med Chem; Design, Synthesis, and Biological Evaluation of New PDE4 Inhibitors for the Treatment of Pressure Ulcers; Authors - Xudong Qian