CACNA1E Polyclonal antibody, PBS Only

• 

  WB analysis using 27225-1-AP (same clone as 27225-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27225-1-AP (CACNA1E antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27225-1-AP (same clone as 27225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27225-1-AP (CACNA1E Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27225-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27225-1-AP (same clone as 27225-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27225-1-AP (CACNA1E Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27225-1-PBS in a different storage buffer formulation.

CACNA1E Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27225-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CACH6, CACNL1A6, Cav2.3

---

Product Information

27225-1-PBS targets CACNA1E in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25944

  Product name: Recombinant human CACNA1E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 801-900 aa of NM_000721

  Sequence: MEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGLALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG

• Full Name: calcium channel, voltage-dependent, R type, alpha 1E subunit
• Calculated Molecular Weight: 262 kDa
• Observed Molecular Weight: 240 kDa
• GenBank Accession Number: NM_000721
• Gene Symbol: CACNA1E
• Gene ID (NCBI): 777
• RRID: AB_2880808
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15878
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CACNA1E is a gene encoding the ion-conducting α1 subunit of R-type voltage-dependent calcium channels, genetic variability of CACNA1E is associated to risk of type 2 diabetes, insulin resistance and impaired insulin secretion in nondiabetic subjects.