C7 Monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 66908-1-Ig (same clone as 66908-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 66908-1-Ig (C7 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66908-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66908-1-Ig (same clone as 66908-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using C7 antibody (66908-1-Ig, Clone: 1H9C4 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 66908-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66908-1-Ig (same clone as 66908-1-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.8 ug C7 Monoclonal antibody (66908-1-Ig, Clone:1H9C4) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1)(red), or 0.8 ug Mouse IgG1 isotype control Mouse McAb (66360-1-Ig, Clone: 1F8D3) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66908-1-PBS in a different storage buffer formulation.

C7 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 66908-1-PBS

Clone No.1H9C4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

1H9C4, complement component 7, Complement component C7

---

Product Information

66908-1-PBS targets C7 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12552

  Product name: Recombinant human C7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 310-690 aa of BC063851

  Sequence: GGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQ

• Full Name: complement component 7
• Calculated Molecular Weight: 843 aa, 94 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC063851
• Gene Symbol: C7
• Gene ID (NCBI): 730
• RRID: AB_2882235
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10643
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C7, a single-chain plasma glycoprotein, is a component of the complement system. It is a constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C7 serves as a membrane anchor. People with C7 deficiency are prone to bacterial infection.