Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells, LNCaP cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 102 publications below |
| IHC | See 9 publications below |
| IF | See 22 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
66665-1-Ig targets Beclin 1 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, hamster, goat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1843 Product name: Recombinant human Beclin 1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 141-450 aa of BC010276 Sequence: TDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK Predict reactive species |
| Full Name | beclin 1, autophagy related |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 52-60 kDa |
| GenBank Accession Number | BC010276 |
| Gene Symbol | Beclin 1 |
| Gene ID (NCBI) | 8678 |
| RRID | AB_2882020 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q14457 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Beclin 1, also known as ATG6 or VPS30, interacts with various cofactors (e.g. Ambra1, Barkor (Atg14), Rubicon, or UVRAG) to regulate the lipid kinase Vps34 and promote the formation of the BECLIN1-Vps34-Vps15 complex, hence inducing autophagy. Its function (via the BH3 domain) is inhibited by Bcl-2 or Bcl-XL. Beclin 1 (BECN1) is a crucial molecule in the control of the autophagic activity, and its activity is regulated by multiple mechanisms, including the post-translational modification, protein-protein interaction, and subcellular localization. It plays a role in crosstalk between apoptosis and autophagy. It has been reported that Beclin 1 can be cleaved into fragments of 50, 37 and 35 kDa during apoptosis. It is involved in many disorders, including neurodegeneration and cancer (tumorigenesis). Beclin 1 is a mammalian tumor suppressor, and its gene is monoallelically deleted in 75% of ovarian, 50% of breast, and 40% of prostate cancers. Decreased expression of Beclin 1 has also been observed in human brain and lung tumors. The level of Beclin 1 was decreased in the affected brain regions of patients with Alzheimer's disease early in the disease process. Recent studies have also shown that gain and loss of Beclin 1 function affects the death of heart cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Beclin 1 antibody 66665-1-Ig | Download protocol |
| IHC protocol for Beclin 1 antibody 66665-1-Ig | Download protocol |
| WB protocol for Beclin 1 antibody 66665-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology Pancreatic acinar cells-derived sphingosine-1-phosphate contributes to fibrosis of chronic pancreatitis via inducing autophagy and activation of pancreatic stellate cells | ||
Adv Sci (Weinh) Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy | ||
Nat Commun IL-6 regulates autophagy and chemotherapy resistance by promoting BECN1 phosphorylation.
| ||
Nat Commun A mosquito salivary protein promotes flavivirus transmission by activation of autophagy. | ||
Cell Death Differ USP11 regulates autophagy-dependent ferroptosis after spinal cord ischemia-reperfusion injury by deubiquitinating Beclin 1 | ||
Autophagy Keratinocyte autophagy enables the activation of keratinocytes and fibroblasts and facilitates wound healing. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Nikolett (Verified Customer) (11-26-2025) | Antibody works well after overnight incubation as 1:1000 on whole cell lysates of NSCLC cell lines.
|









