BMPR1B Recombinant monoclonal antibody, PBS Only

• 

BMPR1B Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83029-7-PBS

Clone No.230244H7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

BMP type 1B receptor, BMP type-1B receptor, BMPR 1B, BMPR-1B, Bone morphogenetic protein receptor type-1B

---

Product Information

83029-7-PBS targets BMPR1B in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Affinity:
  K_D=9.83 x 10^-10M
  K_Off=4.89 x 10^-4M
  K_On=4.97 x 10^5M
• Immunogen:

  CatNo: Ag24902

  Product name: Recombinant human BMPR1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-57 aa of BC047773

  Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI

• Full Name: bone morphogenetic protein receptor, type IB
• Calculated Molecular Weight: 57 kDa
• GenBank Accession Number: BC047773
• Gene Symbol: BMPR1B
• Gene ID (NCBI): 658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00238
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.