BMP4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86168-1-RR (same clone as 86168-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86168-1-RR (BMP4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86168-1-PBS in a different storage buffer formulation.

BMP4 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86168-1-PBS

Clone No.250803D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

BMP 4, BMP-4, BMP2B, BMP-2B, Bone morphogenetic protein 2B

---

Product Information

86168-1-PBS targets BMP4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3191

  Product name: Recombinant human BMP4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 24-408 aa of BC020546

  Sequence: ASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEAISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

• Full Name: bone morphogenetic protein 4
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC020546
• Gene Symbol: BMP4
• Gene ID (NCBI): 652
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12644
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

BMP4, also named as BMP2B and DVR4, belongs to the TGF-beta family. BMPs have been shown to promote astroglial differentiation both in vitro and in vivo. BMP4 have been shown to be components of serum and are thought to be responsible for this differentiation. BMP4 are expressed mainly in neurons, with minimal expression detected in astrocytes and oligodendrocytes.