CoraLite®555-conjugated BCL2 Recombinant monoclonal antibody

BCL2 Uni-rAb® Recombinant Antibody for IF-P, FC (Intra)
Cat No. CL555-80313
Clone No.3O5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF-P, FC (Intra)

BCL-2, 3O5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman appendicitis tissue
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-80313 targets BCL2 in IF-P, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3508

Product name: Recombinant human BCL2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-239 aa of BC027258

Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Predict reactive species
Full Name B-cell CLL/lymphoma 2
Calculated Molecular Weight 26 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberBC027258
Gene Symbol BCL2
Gene ID (NCBI) 596
RRIDAB_2934693
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10415
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BCL2 belongs to the Bcl-2 family. It suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. BCL2 regulates cell death by controlling the mitochondrial membrane permeability (PMID: 10365962). It appears to function in a feedback loop system with caspases. BCL2 inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1) (PMID: 10444588).

Protocols

Product Specific Protocols
FC protocol for CL555 BCL2 antibody CL555-80313Download protocol
IF protocol for CL555 BCL2 antibody CL555-80313Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...