• Featured Product
  • KD/KO Validated

BAX Monoclonal antibody

BAX Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 60267-1-Ig
Clone No.4G5E8

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

4G5E8, Apoptosis regulator BAX, Bcl2-L-4, Bcl-2-like protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, EC109 cells, HepG2 cells, human testis tissue, HEK-293 cells, COLO 320 cells, PC-12 cells, ROS1728 cells, Neuro-2a cells
Positive IP detected inTHP-1 cells
Positive IHC detected inhuman liver cancer tissue, human colon cancer tissue, human kidney tissue, human lung cancer tissue, human rectal cancer tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60267-1-Ig targets BAX in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, hamster
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21068

Product name: Recombinant human BAX protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-192 aa of BC014175

Sequence: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Predict reactive species
Full Name BCL2-associated X protein
Calculated Molecular Weight 21 kDa
Observed Molecular Weight 21 kDa
GenBank Accession NumberBC014175
Gene Symbol BAX
Gene ID (NCBI) 581
RRIDAB_2848213
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ07812
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

BAX, also named as BCL2L4, is a pro-apoptotic member of the Bcl-2 protein family, which plays a pivotal role in controlling cell life and death. Bax largely localizes to the cytoplasm of healthy cells, but accumulates on the outer mitochondrial membrane upon apoptosis induction (PMID: 9108035). BAX can commit a cell to apoptosis by translocation from the cytosol to the mitochondria and permeabilization of the outer mitochondrial membrane, which leads to the release of cytochrome c from mitochondria (PMID: 21763611). The expression of BAX is upregulated by the tumor suppressor protein p53, and BAX has been shown to be involved in p53-mediated apoptosis (PMID: 8183579).

Protocols

Product Specific Protocols
IF protocol for BAX antibody 60267-1-IgDownload protocol
IHC protocol for BAX antibody 60267-1-IgDownload protocol
IP protocol for BAX antibody 60267-1-IgDownload protocol
WB protocol for BAX antibody 60267-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Mitochondrial tRNAGlu 14693A>G Mutation, an "Enhancer" to the Phenotypic Expression of Leber's Hereditary Optic Neuropathy

Authors - Lihao Jin
rat,mouseWB,IHC

Acta Pharm Sin B

Protocatechuic aldehyde protects cardiomycoytes against ischemic injury via regulation of nuclear pyruvate kinase M2.

Authors - Xunxun Wu
mouseWB

Acta Pharm Sin B

Melatonin receptor 1a alleviates sleep fragmentation-aggravated testicular injury in T2DM by suppression of TAB1/TAK1 complex through FGFR1

Authors - Xiaohui Zhang
humanWB

Cell Death Differ

ZNF451 collaborates with RNF8 to regulate RNF168 localization and amplify ubiquitination signaling to promote DNA damage repair and regulate radiosensitivity

Authors - Feng Xu
ratWB

J Adv Res

Evolocumab prevents atrial fibrillation in rheumatoid arthritis rats through restraint of PCSK9 induced atrial remodeling

Authors - Xuejie Han
WB

J Nanobiotechnology

Nanocomposites based on nanoceria regulate the immune microenvironment for the treatment of polycystic ovary syndrome

Authors - Sisi Yan
Loading...
||
New chat Able
正在加载,请稍候...