• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated BAG6 Monoclonal antibody

BAG6 Monoclonal Antibody for WB, FC (Intra)
Cat No. CL488-66661
Clone No.1B8D3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, FC (Intra)

BAT3, BCL2-associated athanogene 6, BAG-6, BAG family molecular chaperone regulator 6, BAG 6

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, LNCaP cells, HepG2 cells, NIH/3T3 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66661 targets BAG6 in WB, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24525

Product name: Recombinant human BAG6 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-184 aa of BC003133

Sequence: MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRME

Predict reactive species
Full Name HLA-B associated transcript 3
Calculated Molecular Weight 119 kDa
Observed Molecular Weight 150-160 kDa
GenBank Accession NumberBC003133
Gene Symbol BAT3/BAG-6
Gene ID (NCBI) 7917
RRIDAB_2934486
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46379
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

BAT3 also known as Scythe or BAG6, is a nuclear protein implicated in the control of apoptosis and natural killer (NK) cell-dendritic cell (DC) interaction. BAT3 was first discovered as a member of a group of genes located within the class III region of the human major histocompatibility complex on chromosome 6, and has been extensively studied for its role in regulating apoptosis under various stress conditions such as DNA damage and endoplasmic reticulum-related stress. BAT3 has been shown to be required for p53 acetylation, which is critical for the enhancement of p53 transcriptional activity in response to DNA damage. In addition, BAT3 is involved in the regulation of development and reproduction of mammals by acting as a co-chaperone of the heat shock protein HSP70.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 BAG6 antibody CL488-66661Download protocol
FC protocol for CL Plus 488 BAG6 antibody CL488-66661Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...