• Featured Product
  • KD/KO Validated

BAG6 Monoclonal antibody, PBS Only

BAG6 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66661-1-PBS
Clone No.1B8D3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

BAT3, 1B8D3, BAG 6, BAG family molecular chaperone regulator 6, BAG-6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66661-1-PBS targets BAG6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24525

Product name: Recombinant human BAG6 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-184 aa of BC003133

Sequence: MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRME

Predict reactive species
Full Name HLA-B associated transcript 3
Calculated Molecular Weight 119 kDa
Observed Molecular Weight 150-160 kDa
GenBank Accession NumberBC003133
Gene Symbol BAT3/BAG-6
Gene ID (NCBI) 7917
RRIDAB_2858188
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP46379
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

BAT3 also known as Scythe or BAG6, is a nuclear protein implicated in the control of apoptosis and natural killer (NK) cell-dendritic cell (DC) interaction. BAT3 was first discovered as a member of a group of genes located within the class III region of the human major histocompatibility complex on chromosome 6, and has been extensively studied for its role in regulating apoptosis under various stress conditions such as DNA damage and endoplasmic reticulum-related stress. BAT3 has been shown to be required for p53 acetylation, which is critical for the enhancement of p53 transcriptional activity in response to DNA damage. In addition, BAT3 is involved in the regulation of development and reproduction of mammals by acting as a co-chaperone of the heat shock protein HSP70.

Loading...
||
New chat

Able

正在加载,请稍候...