ATP5L Monoclonal antibody, PBS Only (Capture)

ATP5L Monoclonal Antibody for IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 60434-1-PBS
Clone No.2D10F9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, Cytometric bead array, Indirect ELISA

ATPase subunit g, ATP5MG, ATP5JG, ATP synthase membrane subunit g, 2D10F9

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60434-1-PBS targets ATP5L as part of a matched antibody pair:

MP50581-1: 60434-1-PBS capture and 60434-2-PBS detection (validated in Cytometric bead array)

MP50581-2: 60434-1-PBS capture and 60434-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9287

Product name: Recombinant human ATP5L protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-103 aa of BC015128

Sequence: MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIANSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV

Predict reactive species
Full Name ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G
Calculated Molecular Weight 11 kDa
GenBank Accession NumberBC015128
Gene Symbol ATP5L
Gene ID (NCBI) 10632
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75964
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mitochondrial membrane ATP synthase (F1-Fo ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of the soluble catalytic core, F1, and the membrane-spanning component and Fo, which comprises the proton channel. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP5L gene encodes ATP synthase subunit g of the Fo complex.

Loading...
||
New chat Able
正在加载,请稍候...