• Featured Product
  • KD/KO Validated

ATM Polyclonal antibody

ATM Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 27156-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, FC (Intra), IP, ChIP, ELISA

A T mutated, A-T mutated, EC:2.7.11.1, Serine-protein kinase ATM

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A549 cells, HeLa cells, HepG2 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman breast cancer tissue, human lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27156-1-AP targets ATM in WB, IHC, IF, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25909

Product name: Recombinant human ATM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1059-1361 aa of BC137169

Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG

Predict reactive species
Full Name ataxia telangiectasia mutated
Observed Molecular Weight 310-350 kDa
GenBank Accession NumberBC137169
Gene Symbol ATM
Gene ID (NCBI) 472
RRIDAB_2880780
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13315
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control.

Protocols

Product Specific Protocols
FC protocol for ATM antibody 27156-1-APDownload protocol
IHC protocol for ATM antibody 27156-1-APDownload protocol
IP protocol for ATM antibody 27156-1-APDownload protocol
WB protocol for ATM antibody 27156-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Sci Transl Med

Guanosine diphosphate-mannose suppresses homologous recombination repair and potentiates antitumor immunity in triple-negative breast cancer

Authors - Jia-Han Ding
mouseWB

Acta Pharm Sin B

Honokiol alleviated neurodegeneration by reducing oxidative stress and improving mitochondrial function in mutant SOD1 cellular and mouse models of amyotrophic lateral sclerosis

Authors - Yujun Zhou
humanWB

Cell Death Differ

p53-dependent elimination of aneuploid mitotic offspring by entosis.

Authors - Jianqing Liang
humanWB

Oncogene

TRIM24 is critical for the cellular response to DNA double-strand breaks through regulating the recruitment of MRN complex

Authors - Ya Wang
WB

Clin Transl Med

Single-cell profiling-guided combination therapy of c-Fos and histone deacetylase inhibitors in diffuse large B-cell lymphoma.

Authors - Luqiao Wang

EBioMedicine

High PARP-1 expression predicts poor survival in acute myeloid leukemia and PARP-1 inhibitor and SAHA-bendamustine hybrid inhibitor combination treatment synergistically enhances anti-tumor effects.

Authors - Xia Li
Loading...
||
New chat

Able

正在加载,请稍候...