Use Able AI chat for product recommendations

ARF1 Monoclonal antibody

ARF1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68069-1-Ig
Clone No. 1C10E3
Publications (3)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IF/ICC, IP, ELISA
For FC, select conjugated version.

1C10E3, ADP ribosylation factor 1, ADP-ribosylation factor 1, EC:3.6.5.2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for ARF1 in ?

Tested Applications

Positive WB detected inA431 cells, LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue
Positive IF/ICC detected inMCF-7 cells, HeLa cells, A431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68069-1-Ig targets ARF1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28021

Product name: Recombinant human ARF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-181 aa of BC009247

Sequence: MGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK

Predict reactive species
Full Name ADP-ribosylation factor 1
Calculated Molecular Weight 21 kDa
Observed Molecular Weight18-21 kDa
GenBank Accession NumberBC009247
Gene Symbol ARF1
Gene ID (NCBI) 375
RRIDAB_2918810
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP84077
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ADP-ribosylation factors (ARFs) are members of the ARF family of GTP-binding proteins of the Ras superfamily. ARFs bind and regulate GTP/GDP cycle by alternating between the active GTP-bound and inactive GDP-bound conformations. ARF family proteins are essential and ubiquitous in eukaryotes. Six highly conserved members of the family have been identified in mammalian cells. They function in vesicular traffic and actin remodelling and other bioprocesses in cells. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. It mainly functions in coat recruitment.(PMID: 7759471, PMID: 16042562).

Protocols

Product Specific Protocols
IF protocol for ARF1 antibody 68069-1-IgDownload protocol
WB protocol for ARF1 antibody 68069-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The ARF1 Monoclonal antibody (1C10E3), catalog number 68069-1-Ig, has 3 total citations. These appear in Nature Biotechnology, Cell Metabolism, and Journal of Nutrition. The associated research fields span mRNA translation initiation (molecular biology), astrocytic mitochondria transfer and brain ischemic stroke (neuroscience), and amino acid signaling in skeletal muscle (nutrition/metabolism). Applications cited include WB and IP across human, mouse, and pig species.

SpeciesApplicationTitle
mouseWB

Nat Biotechnol

Programmable initiation of mRNA translation by trans-RNA

Authors - Longfei Jia
humanWB,IP

Cell Metab

Astrocytic LRP1 enables mitochondria transfer to neurons and mitigates brain ischemic stroke by suppressing ARF1 lactylation

Authors - Jian Zhou
pigWB,IP

J Nutr

Amino Acid Signaling in Skeletal Muscle Is Blunted by Prematurity in a Piglet Model.

Authors - Antonio C Ramos dos Santos
Loading...
||
New chat

Able™

正在加载,请稍候...