Tested Applications
| Positive WB detected in | mouse liver tissue, SKOV-3 cells, mouse kidney tissue, mouse heart tissue, mouse brain tissue, rat brain tissue, rat heart tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue, rat brain tissue, mouse heart tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
| Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:2500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16473-1-AP targets Aquaporin 4 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9561 Product name: Recombinant human AQP4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 208-323 aa of BC022286 Sequence: TGASMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV Predict reactive species |
| Full Name | Aquaporin 4 |
| Calculated Molecular Weight | 323 aa, 35 kDa |
| Observed Molecular Weight | 35-37 kDa, 32-34 kDa |
| GenBank Accession Number | BC022286 |
| Gene Symbol | Aquaporin 4 |
| Gene ID (NCBI) | 361 |
| RRID | AB_2827426 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55087 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Aquaporins are specialized water transport channels in plasma membranes of water-permeable tissues. Aquaporin-4 (AQP4) is the most abundant water channel in the human central nervous system and is important to fluid movements in brain. Aquaporin-4 exists as two isoforms, a long (M1) isoform with translation initiation at Met-1, and a shorter (M23) isoform with translation initiation at Met-23, with molecular weights around 35-37 kDa and 32-34 kDa, respectively.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Aquaporin 4 antibody 16473-1-AP | Download protocol |
| IHC protocol for Aquaporin 4 antibody 16473-1-AP | Download protocol |
| IP protocol for Aquaporin 4 antibody 16473-1-AP | Download protocol |
| WB protocol for Aquaporin 4 antibody 16473-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-AQP4 antibody (Cat# 16473-1-AP) has accumulated 163 citations published in journals including Nature, Cell, Nature Communications, Brain, Journal of Clinical Investigation, Alzheimer's & Dementia, Journal of Neuroinflammation, and Science Reports. Research fields predominantly cover neuroscience (glymphatic dysfunction, blood-brain barrier disruption, ischemic stroke, Alzheimer's disease, spinal cord injury, hydrocephalus), immunology (neuromyelitis optica, neuroinflammation), oncology (glioma), pharmacology, gastroenterology, cardiology, ophthalmology, and veterinary science. Main applications include Western blot, immunofluorescence, immunohistochemistry, and immunoprecipitation.
| Species | Application | Title |
|---|---|---|
Nature Mitochondrial transfer from glia to neurons protects against peripheral neuropathy. | ||
Cell Distinct cellular phenotypes of language and executive decline in amyotrophic lateral sclerosis. | ||
Cell Comprehensive human proteome profiles across a 50-year lifespan reveal aging trajectories and signatures | ||
Nat Commun Single-cell analysis of dup15q syndrome reveals developmental and postnatal molecular changes in autism | ||
J Adv Res Aquaporin 4 and its isoforms regulation ameliorate AQP4 Mis-localization-induced glymphatic dysfunction in ischemic stroke | ||
J Clin Invest MicroRNA-26a-3p rescues depression-like behaviors in male rats via preventing hippocampal neuronal anomalies. |
Reviews
What customers say
Users report consistently positive results with this antibody across applications. Three out of four reviewers gave 5 stars. Immunofluorescence users observed clear and strong staining in neurons, human primary cells, and FFPE brain cortex tissue. One Western blot user at 1:2000 dilution was very satisfied and highly recommended the product. The only minor concern noted was that strong staining in brain cortex made quantitative analysis somewhat challenging. Overall, reviewers found the antibody reliable and effective at various dilutions (1:100 to 1:2000).
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
GARGI (Verified Customer) (08-07-2025) | Nice and clear staining using this antibody
|
Paula (Verified Customer) (07-30-2024) | Worked well for human primary cell line, dilution used 1:500 (secondary 1:400)
 |
aidan (Verified Customer) (07-27-2024) | Very happy with this antibody would highly recommend. Overnight 4degrees, 1:2000. Bis tris gel. Secondary 1:4000 HRP 1h RT.
 |
Reyes (Verified Customer) (04-05-2024) | Aquaporin 4 (in green) shows a strong stainning, although difficult for the analyses, in human FFPE brain cortex.
 |
