APH1A Polyclonal antibody

• 

  WB analysis using 11643-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11643-1-AP (APH1A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11643-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11643-1-AP (APH1A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 11643-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11643-1-AP (APH1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11643-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11643-1-AP (APH1A antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11643-1-AP

  IP result of anti-APH1A (IP:11643-1-AP, 4ug; Detection:11643-1-AP 1:4000) with HeLa cells lysate 1600 ug.

• 

  IHC staining of human stomach using 11643-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11643-1-AP (APH1A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach using 11643-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 11643-1-AP (APH1A antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 11643-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using APH1A antibody (11643-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

APH1A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11643-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

APH 1A, Aph 1alpha, APH-1a, Aph-1alpha, CGI 78

---

Tested Applications

• Positive WB detected in: HT-29 cells, HeLa cells, human brain tissue, U-937 cells, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below

Product Information

11643-1-AP targets APH1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2238

  Product name: Recombinant human APH1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-265 aa of BC015568

  Sequence: MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLLCRRQEDSRVMVYSALRIPPED

• Full Name: anterior pharynx defective 1 homolog A (C. elegans)
• Calculated Molecular Weight: 265 aa, 29 kDa
• Observed Molecular Weight: 27-32 kDa
• GenBank Accession Number: BC015568
• Gene Symbol: APH1A
• Gene ID (NCBI): 51107
• RRID: AB_2242861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BI3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

APH1A is a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Mouse	WB	Transl Psychiatry; A diet high in sugar and fat influences neurotransmitter metabolism and then affects brain function by altering the gut microbiota.; Authors - Yinrui Guo
mouse	WB	Mol Neurobiol; Memantine, a Noncompetitive N-Methyl-D-Aspartate Receptor Antagonist, Attenuates Cerebral Amyloid Angiopathy by Increasing Insulin-Degrading Enzyme Expression.; Authors - Yasuteru Inoue
human	WB	Front Neurosci; Impacts of Acute Hypoxia on Alzheimer's Disease-Like Pathologies in APPswe/PS1dE9 Mice and Their Wild Type Littermates.; Authors - Feng Zhang
mouse	WB	Neurosci Lett; Metformin attenuates vascular pathology by increasing expression of insulin-degrading enzyme in a mixed model of cerebral amyloid angiopathy and type 2 diabetes mellitus.; Authors - Yasuteru Inoue
human	WB	J Allergy Clin Immunol; NETs activate Notch- γ secretase signaling in hidradenitis suppurativa; Authors - Christopher B Oliveira