AMPK Alpha 1 Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66536-1-Ig (same clone as 66536-1-PBS)

  WB result of AMPK alpha antibody (66536-1-Ig; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-AMPK alpha transfected HEK-293 cells. This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66536-1-Ig (same clone as 66536-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66536-1-Ig (same clone as 66536-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66536-1-Ig (same clone as 66536-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66536-1-Ig (same clone as 66536-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66536-1-Ig (same clone as 66536-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66536-1-Ig (same clone as 66536-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66536-1-Ig (AMPK alpha antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66536-1-Ig (same clone as 66536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66536-1-Ig (AMPK alpha antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66536-1-Ig (same clone as 66536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66536-1-Ig (AMPK alpha antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66536-1-Ig (same clone as 66536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66536-1-Ig (AMPK alpha antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66536-1-Ig (same clone as 66536-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66536-1-Ig (AMPK alpha antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66536-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

AMPK Alpha 1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66536-1-PBS

Clone No.1H8E1

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, Mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

AMPK, AMPK alpha, AMPK Alpha 1, AMPK subunit alpha 1, AMPK1, AMPKa1, PRKAA1

---

Product Information

66536-1-PBS targets AMPK Alpha 1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Rat, Mouse samples.

• Tested Reactivity: Human, Rat, Mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24744

  Product name: Recombinant human AMPK alpha protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-207 aa of BC012622

  Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH

• Full Name: protein kinase, AMP-activated, alpha 1 catalytic subunit
• Calculated Molecular Weight: 63 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC012622
• Gene Symbol: AMPK Alpha 1
• Gene ID (NCBI): 5562
• RRID: AB_2881899
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13131
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing.