AIF Polyclonal antibody

• 

  WB analysis of HeLa using 17984-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17984-1-AP (AIF antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 17984-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17984-1-AP (AIF antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17984-1-AP

  WB result of AIF antibody (17984-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AIF transfected HeLa cells.

• 

  IP experiment of HeLa using 17984-1-AP

  IP result of anti-AIF (IP:17984-1-AP, 3ug; Detection:17984-1-AP 1:2000) with HeLa cells lysate 1320ug.

• 

  IHC staining of human kidney using 17984-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17984-1-AP (AIF Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human kidney using 17984-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 17984-1-AP (AIF Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of mouse kidney using 17984-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 17984-1-AP (AIF antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse stomach using 17984-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 17984-1-AP (AIF antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 17984-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17984-1-AP (AIF antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 17984-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using AIF antibody (17984-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

AIF Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17984-1-AP

Publications(89)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

AIFM1, PDCD8, EC:1.6.99.-, Apoptosis-inducing factor 1, mitochondrial

---

Tested Applications

• Positive WB detected in: HeLa cells, NIH/3T3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human kidney tissue, mouse kidney tissue, mouse stomach tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 78 publications below
• IHC: See 7 publications below
• IF: See 21 publications below

Product Information

17984-1-AP targets AIF in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, canine, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12400

  Product name: Recombinant human AIF protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 259-609 aa of BC111065

  Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

• Full Name: apoptosis-inducing factor, mitochondrion-associated, 1
• Calculated Molecular Weight: 609 aa, 66 kDa
• Observed Molecular Weight: 67 kDa, 57 kDa
• GenBank Accession Number: BC111065
• Gene Symbol: AIF
• Gene ID (NCBI): 9131
• RRID: AB_2224539
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Apoptosis-inducing factor (AIF) is one of the mitochondrial proteins to be released into the cytosol during apoptosis, and it is discovered as the first protein that regulates caspase-independent apoptosis(PMID:20494118). AIF is encoded as a 67 kDa protein that contains a mitochondrial localization signal (MLS) in the N-terminus.It is cleaved from the 62 kDa to the 57 kDa form following ischemic injury and translocated from the mitochondria to the nucleus in a calpain-dependent manner(PMID: 25101006).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell Rep; Newly synthesized AIFM1 determines the hypersensitivity of T lymphocytes to STING activation-induced cell apoptosis; Authors - Wangsheng Ji ; KD Validated
rat	WB	Phytomedicine; LC-MS based metabonomics study on protective mechanism of ESWW in cerebral ischemia via CYTC/Apaf-1/NDRG4 pathway; Authors - Yan Liang
rat	WB	Oxid Med Cell Longev; miRNA-27a Transcription Activated by c-Fos Regulates Myocardial Ischemia-Reperfusion Injury by Targeting ATAD3a.; Authors - Yandong Bao
human	WB	Elife; Genome-wide CRISPRi screening identifies OCIAD1 as a prohibitin client and regulatory determinant of mitochondrial Complex III assembly in human cells.; Authors - Maxence Le Vasseur
human	WB	PLoS Pathog; GP73 represses host innate immune response to promote virus replication by facilitating MAVS and TRAF6 degradation.; Authors - Xuewu Zhang
human	WB	J Med Chem; Anticancer Effects of Honokiol via Mitochondrial Dysfunction Are Strongly Enhanced by the Mitochondria-Targeting Carrier Berberine.; Authors - Xiaojia Shi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Tom (Verified Customer) (11-13-2020)

HeLa cells permeablisied (0.1% Triton X-100 in PBS) then blocked (1% BSA in PBS). Cells incubated with primary antibody (1:100) for 1 hour, 3xPBS prior to 1 hour incubation with goat anti-rabbit 488 Alexa Fluor secondary antibody.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: HeLa

AIF Antibody Immunofluorescence validation (1:100 dilution) in HeLa (Cat no:17984-1-AP)

FH

Praveen (Verified Customer) (05-17-2019)

Excellent Antibody

• Applications: Western Blot,
• Cell Tissue Type: AC16

AIF Antibody Western Blot, validation ( dilution) in AC16 (Cat no:17984-1-AP)