Fetuin-A/AHSG Polyclonal antibody

Fetuin-A/AHSG Polyclonal Antibody for WB, IHC, ELISA
Cat No. 16571-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, ELISA

AHSG, Fetuin-A, Alpha-2-HS-glycoprotein, Alpha 2 Z globulin, alpha 2 HS glycoprotein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman liver tissue, human heart tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16571-1-AP targets Fetuin-A/AHSG in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, plasmodium falciparum
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9853

Product name: Recombinant human AHSG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-367 aa of BC048198

Sequence: MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

Predict reactive species
Full Name alpha-2-HS-glycoprotein
Calculated Molecular Weight 367 aa, 39 kDa
Observed Molecular Weight 58 kDa
GenBank Accession NumberBC048198
Gene Symbol Fetuin-A
Gene ID (NCBI) 197
RRIDAB_2224119
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02765
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fetuin-A, also named as Alpha2-HS glycoprotein (AHSG), is a member of cystatin superfamily of protease inhibitors. It is a highly expressed glycoprotein in various fetal tissues whereas it is mainly expressed by the liver in adults. Fetuin A, an extracellular inhibitor of transforming growth factor β, is a profibrogenic stimulus in liver disease. Circulating fetuin-A may be a beneficial serum biomarker in the detection of liver and vascular fibrosis progression in patients with non-alcoholic fatty liver disease. It is also involved in several functions, such as endocytosis, brain development and the formation of bone tissue. Fetuin-A exerts its effects on the cardiovascular system by two different mechanisms. On the one hand it inhibits ins signaling and induces ins resistance contributing to the onset of atherosclerosis and on the other hand it inhibits calcium deposition and protects from vascular calcification.

Protocols

Product Specific Protocols
IHC protocol for Fetuin-A/AHSG antibody 16571-1-APDownload protocol
WB protocol for Fetuin-A/AHSG antibody 16571-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Front Cell Dev Biol

Plasma Exosomes Derived From Patients With End-Stage Renal Disease and Renal Transplant Recipients Have Different Effects on Vascular Calcification.

Authors - Xiao Lin
humanIHC, WB

Osteoarthritis Cartilage

Proteomics analysis of hip articular cartilage identifies differentially expressed proteins associated with osteonecrosis of the femoral head.

Authors - J Song
ratWB

J Pharm Biomed Anal

Integrated cartilage metabolomics and proteomics analysis reveals the therapeutic effect of Wenjing Tongluo Decoction on Knee osteoarthritis rats

Authors - Wei Wei
Plasmodium falciparumWB

Malar J

The malaria parasite Plasmodium falciparum in red blood cells selectively takes up serum proteins that affect host pathogenicity.

Authors - Takahiro Tougan
humanIHC

Bioengineered

Alpha-2 Heremans Schmid Glycoprotein (AHSG) promotes the proliferation of bladder cancer cells by regulating the TGF-β signalling pathway.

Authors - Yufei Dong
humanWB

Adv Sci (Weinh)

3D-hUMSCs Exosomes Ameliorate Vitiligo by Simultaneously Potentiating Treg Cells-Mediated Immunosuppression and Suppressing Oxidative Stress-Induced Melanocyte Damage

Authors - Qi Wang
Loading...
||
New chat Able
正在加载,请稍候...