AGTR2 Polyclonal antibody

• 

  WB analysis using 30963-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30963-1-AP (AGTR2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 30963-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using AGTR2 antibody (30963-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

AGTR2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30963-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

AGTR 2, Angiotensin II type 2 receptor, AT2, ATGR2, Type 2 angiotensin II receptor

---

Tested Applications

• Positive WB detected in: A549 cells, HepG2 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30963-1-AP targets AGTR2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33887

  Product name: Recombinant human AGTR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-45 aa of NM_000686

  Sequence: MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD

• Full Name: angiotensin II receptor, type 2
• Calculated Molecular Weight: 41 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: NM_000686
• Gene Symbol: AGTR2
• Gene ID (NCBI): 186
• RRID: AB_3669797
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P50052
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AGTR2 (angiotensin II type 2 receptor) is part of the renin-angiotensin signaling (RAS) pathway that has been widely studied for its role in blood pressure regulation and renal and cardiovascular health (PMID: 29937318). AGTR2 mediates the effects of angiotensin II on cellular differentiation and growth (PMID: 30455538).