AGER/RAGE Polyclonal antibody

• 

  WB analysis using 16346-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16346-1-AP (AGER/RAGE antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 16346-1-AP (AGER/RAGE antibody) at dilution of 1:4000 (under 10x lens).

• 

  IHC staining of mouse lung using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 16346-1-AP (AGER/RAGE antibody) at dilution of 1:4000 (under 40x lens).

• 

  IHC staining of human lung using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 16346-1-AP (AGER antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9).

• 

  IHC staining of human renal cell carcinoma using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 16346-1-AP (AGER Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human renal cell carcinoma using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 16346-1-AP (AGER Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human lung using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 16346-1-AP (AGER antibody) at dilution of 1:4000 (under 10x lens).

• 

  IF Staining of mouse lung using 16346-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse lung tissue using AGER/RAGE antibody (16346-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

AGER/RAGE Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 16346-1-AP

Publications(51)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

RAGE, AGER, Advanced glycosylation end product-specific receptor

---

Tested Applications

• Positive WB detected in: mouse lung tissue, rat lung tissue
• Positive IHC detected in: mouse lung tissue, human lung tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 38 publications below
• IHC: See 10 publications below
• IF: See 11 publications below

Product Information

16346-1-AP targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9540

  Product name: Recombinant human AGER protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-340 aa of BC020669

  Sequence: ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 404 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC020669
• Gene Symbol: AGER
• Gene ID (NCBI): 177
• RRID: AB_2878246
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15109
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a member of the immunoglobulin superfamily of cell surface receptors, which interacts with distinct families of ligands, mediating diverse functions in a broad array of cell types including cellular migration, proliferation, survival and apoptosis (PMID: 12645002; 17425919). It senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PMID: 19910580; 28627626). It interacts with distinct molecules implicated in homeostasis, development, inflammation, and certain diseases such as diabetes and Alzheimer's disease (PMID: 26253613; 31079281).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	EMBO J; A novel human fetal lung-derived alveolar organoid model reveals mechanisms of surfactant protein C maturation relevant to interstitial lung disease; Authors - Kyungtae Lim
Rat		Oxid Med Cell Longev; l-Theanine Ameliorates d-Galactose-Induced Brain Damage in Rats via Inhibiting AGE Formation and Regulating Sirtuin1 and BDNF Signaling Pathways.; Authors - Li Zeng
rat	IF,WB	J Neuroinflammation; Inhibiting HMGB1-RAGE axis prevents pro-inflammatory macrophages/microglia polarization and affords neuroprotection after spinal cord injury.; Authors - Hong Fan
mouse	WB	J Neuroinflammation; Celastrol exerts a neuroprotective effect by directly binding to HMGB1 protein in cerebral ischemia-reperfusion.; Authors - Dan-Dan Liu
human,mouse	WB,IHC	Mol Med; AGEs promote atherosclerosis by increasing LDL transcytosis across endothelial cells via RAGE/NF-κB/Caveolin-1 pathway; Authors - Meng Shu ; KD Validated
mouse	WB	Front Pharmacol; Protective effect of heat-processed Gynostemma pentaphyllum on high fat diet-induced glucose metabolic disorders mice; Authors - Jin-Bo Xie