AGER/RAGE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AGER/RAGE Polyclonal antibody (16346-1-AP)

• Featured Product
• KD/KO Validated

AGER/RAGE Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 16346-1-AP

Publications(81)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

AGER, RAGE, Advanced glycosylation end product-specific receptor

• 

  WB analysis using 16346-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16346-1-AP (AGER/RAGE antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 16346-1-AP (AGER/RAGE antibody) at dilution of 1:4000 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 16346-1-AP (AGER/RAGE antibody) at dilution of 1:4000 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 16346-1-AP (AGER antibody) at dilution of 1:4000 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 16346-1-AP (AGER antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 16346-1-AP (AGER Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human renal cell carcinoma using 16346-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 16346-1-AP (AGER Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse lung using 16346-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse lung tissue using AGER/RAGE antibody (16346-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse lung tissue, rat lung tissue
• Positive IHC detected in: mouse lung tissue, human lung tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16346-1-AP targets AGER/RAGE in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9540

  Product name: Recombinant human AGER protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-340 aa of BC020669

  Sequence: ITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGT

• Full Name: advanced glycosylation end product-specific receptor
• Calculated Molecular Weight: 404 aa, 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC020669
• Gene Symbol: AGER
• Gene ID (NCBI): 177
• RRID: AB_2878246
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15109
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Advanced glycosylation end product-specific receptor (AGER, also known as RAGE) is a member of the immunoglobulin superfamily of cell surface receptors, which interacts with distinct families of ligands, mediating diverse functions in a broad array of cell types including cellular migration, proliferation, survival and apoptosis (PMID: 12645002; 17425919). It senses endogenous stress signals with a broad ligand repertoire including advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids and glycosaminoglycans (PMID: 19910580; 28627626). It interacts with distinct molecules implicated in homeostasis, development, inflammation, and certain diseases such as diabetes and Alzheimer's disease (PMID: 26253613; 31079281).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	IF	Signal Transduct Target Ther; Inducible CD147 up-regulation boosts extended SARS-CoV-2 infection triggering severe COVID-19 independent of ACE2.; Authors - Ke Wang
human	IF	Science; Macrophage peroxisomes guide alveolar regeneration and limit SARS-CoV-2 tissue sequelae; Authors - Xiaoqin Wei
		Bioact Mater; Intelligent responsive alloy scaffold temporally regulates the immune-osteogenic axis for the treatment of infectious bone defects.; Authors - Dong Ruan
		J Extracell Vesicles; S100A9 Aggravates Cardiac Fibrosis by TLR4/PGC-1α Mediated Macrophage-Myofibroblast Crosstalk.; Authors - Yiting Zhao
mouse	WB	Nat Commun; Interleukin-11 causes alveolar type 2 cell dysfunction and prevents alveolar regeneration; Authors - Benjamin Ng
human	WB	Nat Commun; S100P is a ferroptosis suppressor to facilitate hepatocellular carcinoma development by rewiring lipid metabolism; Authors - Min Yang ; KD Validated