ACDP1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 25279-1-AP (same clone as 25279-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25279-1-AP (ACDP1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 25279-1-AP (same clone as 25279-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 25279-1-AP (ACDP1 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25279-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 25279-1-AP (same clone as 25279-1-PBS)

  IP result of anti-ACDP1 (IP:25279-1-AP, 4ug; Detection:25279-1-AP 1:1000) with mouse brain tissue lysate 3000ug. This data was developed using the same antibody clone with 25279-1-PBS in a different storage buffer formulation.

ACDP1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 25279-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

25279-1-PBS targets ACDP1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17221

  Product name: Recombinant human CNNM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 693-951 aa of BC098103

  Sequence: GAFTYYGVPAIMTTACSDNDVRKVGSLAGSSVFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSSNNLYMPDYSVHILSDVQFVKITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLTLSPAAVPTRAASDSECCNINLDTETSPCSSDFEENVGKKLLRTLSGQKRKRSPEGERTSEDNSNLTPLIT

• Full Name: cyclin M1
• Calculated Molecular Weight: 880 aa, 97 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC098103
• Gene Symbol: CNNM1
• Gene ID (NCBI): 26507
• RRID: AB_2880004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRU3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.