ABHD4 Polyclonal antibody, PBS Only

• 

  WB analysis using 32036-1-AP (same clone as 32036-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32036-1-AP (ABHD4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32036-1-PBS in a different storage buffer formulation.

ABHD4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32036-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

32036-1-PBS targets ABHD4 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36373

  Product name: Recombinant human ABHD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-342 aa of BC024779

  Sequence: PSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKKVKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD

• Full Name: abhydrolase domain containing 4
• Calculated Molecular Weight: 342 aa, 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC024779
• Gene Symbol: ABHD4
• Gene ID (NCBI): 63874
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8TB40
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The alpha/beta hydrolase structural domain-containing protein 4 (ABHD4) gene is a major regulator of mammalian phospholipid metabolism with hydrolase and lysophospholipase activities. ABHD4 is involved in anoikis resistance and endogenous cannabinoid biosynthesis, and ABHD4-mediated developmental anoikis specifically protects embryonic brains from the consequences of sporadic delamination errors and teratogenic damage.