Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

14-3-3 Epsilon Polyclonal antibody

14-3-3 Epsilon Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA
For FC, select conjugated version.

14-3-3E, YWHAE, 14-3-3 protein epsilon, 14-3-3epsilon

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for 14-3-3 Epsilon in ?

Tested Applications

Positive WB detected inA375 cells, HeLa cells
Positive IP detected inA375 cells
Positive IHC detected inhuman colon tissue, human gliomas tissue, human lung cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:5000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11648-2-AP targets 14-3-3 Epsilon in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2247

Product name: Recombinant human 14-3-3E protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-255 aa of BC000179

Sequence: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ

Predict reactive species
Full Name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
Calculated Molecular Weight 255 aa, 29 kDa
Observed Molecular Weight 29-32 kDa
GenBank Accession NumberBC000179
Gene Symbol 14-3-3E
Gene ID (NCBI) 7531
RRIDAB_2217787
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP62258
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

14-3-3 Epsilon (also known as YWHAE) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised against full-length 14-3-3 Epsilon.

Protocols

Product Specific Protocols
IF protocol for 14-3-3 Epsilon antibody 11648-2-APDownload protocol
IHC protocol for 14-3-3 Epsilon antibody 11648-2-APDownload protocol
IP protocol for 14-3-3 Epsilon antibody 11648-2-APDownload protocol
WB protocol for 14-3-3 Epsilon antibody 11648-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The 14-3-3ε antibody (Cat# 11648-2-AP) has 25 citations across 23 journals, including Nature Immunology, Nature Communications, Cell Host & Microbe, EMBO Journal, and Cell Reports. Research fields span viral infections (dengue, Zika, SARS-CoV-2, influenza), oncology (lung, breast, colorectal, gastric cancers), neurodegeneration (Alzheimer's, α-synuclein), cardiovascular disease, innate immunity, ferroptosis, and phase separation.

SpeciesApplicationTitle
humanWB,IF

Nat Immunol

A phosphomimetic-based mechanism of dengue virus to antagonize innate immunity.

Authors - Ying Kai Chan
humanIP

Cell Host Microbe

Zika Virus NS3 Mimics a Cellular 14-3-3-Binding Motif to Antagonize RIG-I- and MDA5-Mediated Innate Immunity.

Authors - William Riedl
humanWB

Nat Commun

Endothelial discoidin domain receptor 1 senses flow to modulate YAP activation

Authors - Jiayu Liu

J Exp Clin Cancer Res

14-3-3ζ inhibits heme oxygenase-1 (HO-1) degradation and promotes hepatocellular carcinoma proliferation: involvement of STAT3 signaling.

Authors - Jia Song
human,canineWB,IF

Cell Mol Biol Lett

AGR2-mediated unconventional secretion of 14-3-3ε and α-actinin-4, responsive to ER stress and autophagy, drives chemotaxis in canine mammary tumor cells

Authors - Stephen Hsien-Chi Yuan
humanWB

Cell Death Dis

Akt kinase LANCL2 functions as a key driver in EGFR-mutant lung adenocarcinoma tumorigenesis.

Authors - Yuqing Lou
Loading...
||
New chat

Able™

正在加载,请稍候...