Filter:
Product Information
85060-3-PBS targets SLC6A1 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag29712 Product name: Recombinant human SLC6A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC033904 Sequence: MATNGSKVADGQISTEVSEAPVANDKPKTLVVKVQKKAADLPDRDTWKGRFD Predict reactive species |
| Full Name | solute carrier family 6 (neurotransmitter transporter, GABA), member 1 |
| Calculated Molecular Weight | 67 kDa |
| GenBank Accession Number | BC033904 |
| Gene Symbol | GABA Transporter 1/GAT1 |
| Gene ID (NCBI) | 6529 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P30531 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
