Mouse ICOS/CD278 Recombinant monoclonal antibody, PBS Only (Capture)

ICOS/CD278 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 85035-2-PBS
Clone No.242639D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

242639D5, Activation-inducible lymphocyte immunomediatory molecule, Ailim, CCLP, CD278

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85035-2-PBS targets ICOS/CD278 as part of a matched antibody pair:

MP01745-2: 85035-2-PBS capture and 85035-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3198

Product name: Recombinant Mouse ICOS/CD278 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 21-144 aa of NM_017480.2

Sequence: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWL

Predict reactive species
Full Name inducible T-cell co-stimulator
Calculated Molecular Weight23kDa
Observed Molecular Weight23 kDa
GenBank Accession NumberNM_017480.2
Gene Symbol Icos
Gene ID (NCBI) 54167
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9WVS0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Inducible T cell co-stimulator (ICOS) is related to the CD28 superfamily and is highly expressed on activated T cells as well as regulatory T cells and is crucial for the survival and function of T cells, Th2 cell differentiation, and lung inflammatory responses. Binding ICOS to ICOS-ligand (ICOS-L) activates a cascade of intracellular signaling molecules that prevent apoptosis and lead to the production of cytokines such as IL-4 and IL-13.

Loading...
||
New chat Able
正在加载,请稍候...