SEC31A Recombinant monoclonal antibody, PBS Only (Capture)

SEC31A Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 84942-3-PBS
Clone No.242531G6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

ABP125, ABP130, KIAA0905, SEC31 like protein 1, SEC31 related protein A

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84942-3-PBS targets SEC31A as part of a matched antibody pair:

MP01696-1: 84942-3-PBS capture and 84942-2-PBS detection (validated in Cytometric bead array)

MP01696-2: 84942-3-PBS capture and 84942-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag12314

Product name: Recombinant human SEC31A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 758-1106 aa of BC084583

Sequence: AAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQRPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV

Predict reactive species
Full Name SEC31 homolog A (S. cerevisiae)
Calculated Molecular Weight 1220 aa, 133 kDa
GenBank Accession NumberBC084583
Gene Symbol SEC31A
Gene ID (NCBI) 22872
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO94979
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...