EOMES/TBR2 Recombinant monoclonal antibody, PBS Only (Capture)

EOMES/TBR2 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83945-4-PBS
Clone No.241036G3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

EOMES, TBR2, Eomesodermin homolog, T box brain protein 2, T brain 2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83945-4-PBS targets EOMES/TBR2 as part of a matched antibody pair:

MP00931-1: 83945-4-PBS capture and 83945-3-PBS detection (validated in Cytometric bead array)

MP00931-2: 83945-4-PBS capture and 83945-1-PBS detection (validated in Cytometric bead array)

MP00931-3: 83945-4-PBS capture and 83945-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27634

Product name: Recombinant human EOMES protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 575-676 aa of NM_001278182

Sequence: MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM

Predict reactive species
Full Name eomesodermin homolog (Xenopus laevis)
Calculated Molecular Weight 73 aa
GenBank Accession NumberNM_001278182
Gene Symbol EOMES
Gene ID (NCBI) 8320
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95936
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...