Tested Applications
| Positive WB detected in | Jurkat cells, A431 cells, MCF-7 cells, SGC-7901 cells |
| Positive FC (Intra) detected in | SH-SY5Y cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83660-1-RR targets SOX4 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag26583 Product name: Recombinant human SOX4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 70-160 aa of BC072668 Sequence: SQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKSGNANSSSSAAASSKPGEKGDKVGG Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 4 |
| Calculated Molecular Weight | 474 aa, 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC072668 |
| Gene Symbol | SOX4 |
| Gene ID (NCBI) | 6659 |
| RRID | AB_3671267 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q06945 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SOX4 is a member of the SOX (SRY-related HMG-box) family of transcription factors that play key roles in the regulation of stemness, differentiation, progenitor cell development, and multiple developmental pathways. A single-exon gene encodes the SOX4 protein and contains a highly conserved high-mobility group (HMG) DNA binding domain related to the TCF/LEF family of transcription factors that play important roles in the Wnt pathway. SOX4 is expressed in stem cells, and modulates stem cell activation and likely also plays a role in stem cell maintenance, possibly through activation of expression of SOX2 (PMID: 23764001, 31445218). The calculated molecular weight of SOX4 is 47 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SOX4 antibody 83660-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









